Dbfetch

ID   L34099; SV 1; linear; mRNA; STD; HUM; 690 BP.
XX
AC   L34099;
XX
DT   17-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human (clone 22) MHC class II HLA-DQB1*0401 mRNA, 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-690
RX   DOI; 10.1111/j.1399-0039.1996.tb02512.x.
RX   PUBMED; 8929711.
RA   Yasunaga S., Kimura A., Hamaguchi K., Ronningen K.S., Sasazuki T.;
RT   "Different contribution of HLA-DR and -DQ genes in susceptibility and
RT   resistance to insulin-dependent diabetes mellitus (IDDM)";
RL   Tissue Antigens 47(1):37-48(1996).
XX
DR   MD5; 33a551689407d5c662a73619e7e14ae7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..690
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="YT"
FT                   /cell_type="B lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..690
FT                   /gene="HLA-DQB1"
FT   exon            <1..13
FT                   /gene="HLA-DQB1"
FT                   /number=1
FT                   /note="allele DQB1*0401; G00-120-517"
FT   CDS             <1..690
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ-beta-1"
FT                   /function="immune regulation"
FT                   /note="allele DQB1*0401; putative"
FT                   /db_xref="GOA:Q30077"
FT                   /db_xref="H-InvDB:HIT000193144_03.4"
FT                   /db_xref="IMGT/HLA:DQB1*04:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30077"
FT                   /protein_id="AAC41967.1"
FT                   /translation="RDSPEDFVFQFKGMCYFTNGTELVRGVTRYIYNREEYARFDSDVG
FT                   VYRAVTPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRRVEPTVTISPS
FT                   RTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEM
FT                   TPQRGDVYTCHVEHPSLQNPIIVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHR
FT                   SQKGLLH"
FT   exon            14..283
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT                   /note="allele DQB1*0401; G00-120-517"
FT   exon            284..565
FT                   /gene="HLA-DQB1"
FT                   /number=3
FT                   /note="allele DQB1*0401; G00-120-517"
FT   exon            566..676
FT                   /gene="HLA-DQB1"
FT                   /number=4
FT                   /note="allele DQB1*0401; G00-120-517"
FT   exon            577..>690
FT                   /gene="HLA-DQB1"
FT                   /number=6
FT                   /note="allele DQB1*0401; G00-120-517"
XX
SQ   Sequence 690 BP; 150 A; 197 C; 209 G; 134 T; 0 other;
     agagactctc ccgaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg        60
     accgagctcg tgcggggtgt gaccagatac atctataacc gagaggagta cgcgcgcttc       120
     gacagcgacg tgggggtgta tcgggcggtg acgccgctgg ggcggcttga cgccgagtac       180
     tggaatagcc agaaggacat cctggaggag gaccgggcgt cggtggacac cgtatgcaga       240
     cacaactacc agttggagct ccgcacgacc ttgcagcggc gagtggagcc cacagtgacc       300
     atctccccat ccaggacaga ggccctcaac caccacaacc tgctggtctg ctcagtgaca       360
     gatttctatc cagcccagat caaagtccgg tggtttcgga atgaccagga ggagacaact       420
     ggcgttgtgt ccacccccct tattaggaac ggtgactgga ccttccagat cctggtgatg       480
     ctggaaatga ctccccagcg tggagacgtc tacacctgcc acgtggagca ccccagcctc       540
     cagaacccca tcatcgtgga gtggcgggct cagtctgaat ctgcccagag caagatgctg       600
     agtggcattg gaggcttcgt gctggggctg atcttcctcg ggctgggcct tattatccat       660
     cacaggagtc agaaagggct cctgcactga                                        690
//