Dbfetch

ID   L34025; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   L34025;
XX
DT   23-DEC-1994 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human (clone DRB1 15Y1) MHC class II HLA-DRB1 (HLA-DRB1-1504 allele) gene,
DE   partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RA   Fei H., Lu Y., Lin B., Jiang W., Zou Y., Chen R.;
RT   "Nucleotide sequence analysis of a new DR15(2) allele from Yi nationality
RT   from China";
RL   Zhonghua Wei Sheng Wu Xue He Mian Yi Xue Za Zhi 15:45-48(1995).
XX
RN   [2]
RP   1-255
RA   Lin B.;
RT   ;
RL   Submitted (22-DEC-1994) to the INSDC.
RL   Biaoyang Lin, Molecular Analysis of Mammalian Mutation Laboratory, ICRF,
RL   London, UK WC2A 3PX
XX
DR   MD5; b6e6aeff0d502cef4b7fb2dead2ebf31.
XX
CC   NCBI gi: 603920
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /strain="Yi"
FT                   /mol_type="genomic DNA"
FT                   /clone="DRB1 15Y1"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DR beta 1"
FT                   /note="HLA-DRB1-1504 allele;  NCBI gi: 971165"
FT                   /db_xref="GOA:Q30130"
FT                   /db_xref="IMGT/HLA:DRB1*15:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30130"
FT                   /protein_id="AAA74994.1"
FT                   /translation="FLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVT
FT                   ELGRPDAEYWNSQKDFLEQARAAVDTYCRHNYGVVESFTV"
FT   variation       181
FT                   /gene="HLA-DRB1"
FT                   /replace="a"
FT                   /note="DR15(2) allele; sequence of other DR2 allele;
FT                   G00-120-642"
XX
SQ   Sequence 255 BP; 51 A; 61 C; 95 G; 48 T; 0 other;
     ttcctgtggc agcctaagag ggagtgtcat ttcttcaatg ggacggagcg ggtgcggttc        60
     ctggacagat acttctataa ccaggaggag tccgtgcgct tcgacagcga cgtgggggag       120
     ttccgggcgg tgacggagct ggggcggcct gacgctgagt actggaacag ccagaaggac       180
     ttcctggagc aggcgcgggc cgcggtggac acctactgca gacacaacta cggggttgtg       240
     gagagcttca cagtg                                                        255
//