Dbfetch

ID   L29082; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   L29082;
XX
DT   05-MAY-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II HLA antigen (HLA-DRB1-0811) allele DR8, partial
DE   cds.
XX
KW   cell surface glycoprotein; integral membrane protein;
KW   major histocompatibility complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RX   DOI; 10.1111/j.1399-0039.1996.tb02616.x.
RX   PUBMED; 8883301.
RA   Smith A.G., Mickelson E.M., McKinney S., Nisperos B.B., Donadi E.,
RA   Martin P.J., Hansen J.A.;
RT   "Six new DR52-associated DRB1 alleles, three of DR8, two of DR11, and one
RT   of DR6, reflect a variety of mechanisms which generate polymorphism in the
RT   MHC";
RL   Tissue Antigens 48(2):118-126(1996).
XX
RN   [2]
RP   1-258
RA   Smith A.G.;
RT   ;
RL   Submitted (24-OCT-1994) to the INSDC.
RL   Anajane G. Smith, Clinical Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, Seattle, WA 98104, USA
XX
DR   MD5; c80fc7ea3ac71133108fd4a32e48cf92.
XX
CC   On Apr 1, 1996 this sequence version replaced gi:476706.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="short arm of chromosome 6"
FT                   /strain="Amerindian"
FT                   /isolate="Tlingit"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>258
FT                   /codon_start=3
FT                   /gene="HLA-DRB1-0811"
FT                   /product="MHC class II HLA antigen"
FT                   /note="DR8 allele"
FT                   /db_xref="GOA:Q30124"
FT                   /db_xref="IMGT/HLA:DRB1*08:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30124"
FT                   /protein_id="AAA93191.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPAAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFT"
XX
SQ   Sequence 258 BP; 54 A; 60 C; 92 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacgg                                                     258
//