spacer

EBI Dbfetch

ID   L27216; SV 1; linear; genomic DNA; STD; HUM; 279 BP.
XX
AC   L27216;
XX
DT   04-JAN-1994 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DRB1 gene (13MC).
XX
KW   class II gene; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-279
RA   Lester S., Cassidy S., McCluskey J.;
RT   ;
RL   Unpublished.
XX
DR   MD5; e40d7bda4e5dfeb7c17175f75105dc5c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..279
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="AD-6168"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="13MC"
FT                   /dev_stage="adult"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <39..>259
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /standard_name="ARS"
FT                   /function="antigen recognition site"
FT                   /db_xref="GOA:Q30128"
FT                   /db_xref="IMGT/HLA:DRB1*13:12:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30128"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA59789.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSA
FT                   EYWNSQKDILEDRRAAVDTYCRHNYGVG"
FT   variation       211..213
FT                   /gene="HLA-DRB1"
FT                   /note="differs from DRB1*1303"
XX
SQ   Sequence 279 BP; 49 A; 52 C; 82 G; 38 T; 58 other;
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnntg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctag cgccgagtac       180
     tggaacagcc agaaggacat cctggaagac aggcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtgn nnnnnnnnnn nnnnnnnnn                              279
//


spacer
spacer