Dbfetch

ID   L26306; SV 1; linear; genomic DNA; STD; HUM; 237 BP.
XX
AC   L26306;
XX
DT   26-NOV-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human DNA sequence with open reading frame.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-237
RX   DOI; 10.1111/j.1399-0039.1994.tb02357.x.
RX   PUBMED; 7974469.
RA   Smith A.G., Safirman C., Kelso C., Amar A., Hansen J.A., Brautbar C.;
RT   "Two new DR52-associated alleles, DRB1*1111 and *1312, identified by
RT   PCR/SSOP and confirmed by DNA sequencing";
RL   Tissue Antigens 44(1):52-56(1994).
XX
DR   MD5; 2d83f2556c51580e7c0a8826d2a67a65.
DR   EuropePMC; PMC523646; 8165136.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..237
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>237
FT                   /codon_start=2
FT                   /note="label:ORF"
FT                   /note="ORF"
FT                   /db_xref="GOA:Q15442"
FT                   /db_xref="IMGT/HLA:DRB1*11:11:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q15442"
FT                   /protein_id="AAA67471.1"
FT                   /translation="SECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDFLEDERAAVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 237 BP; 52 A; 53 C; 87 G; 45 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcta        60
     taaccaagag gagtacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgagg agtactggaa cagccagaag gacttcctgg aagacgagcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggtt ggtgagagct tcacagt          237
//