spacer

EBI Dbfetch

ID   L24373; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   L24373;
XX
DT   21-SEP-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class I antigen (HLA-B73) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RX   DOI; 10.1111/j.1744-313X.1995.tb00237.x.
RX   PUBMED; 8547229.
RA   Hoffmann H.J., Kristensen T.J., Jensen T.G., Graugaard B., Lamm L.U.;
RT   "Antigenic characteristics and cDNA sequences of HLA-B73";
RL   Eur. J. Immunogenet. 22(3):231-240(1995).
XX
DR   MD5; ecabf07cf87e7667428446074e43bdf7.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p2.1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1101
FT                   /gene="HLA-B73"
FT   CDS             1..1092
FT                   /codon_start=1
FT                   /gene="HLA-B73"
FT                   /product="MHC class I antigen"
FT                   /note="transmembrane domain of HLA-B73 is one aa longer
FT                   than the canonical sequence"
FT                   /db_xref="GOA:Q31612"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*73:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q31612"
FT                   /protein_id="AAA96733.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKAKAQTDRVGLRN
FT                   LRGYYNQSEDGSHTWQTMYGCDMGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQSTIPIVGIVAGLAVLVVTVAVVAVVAAVMCRRKSSGG
FT                   KGGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     1..72
FT                   /gene="HLA-B73"
FT   exon            1..73
FT                   /gene="HLA-B73"
FT                   /number=1
FT   mat_peptide     73..1089
FT                   /gene="HLA-B73"
FT                   /product="unnamed"
FT   misc_feature    73..342
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 1"
FT   exon            74..343
FT                   /gene="HLA-B73"
FT                   /number=2
FT   misc_feature    343..618
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 2"
FT   exon            344..619
FT                   /gene="HLA-B73"
FT                   /number=3
FT   misc_feature    373..534
FT                   /gene="HLA-B73"
FT                   /note="Region: intrachain S-S"
FT   misc_feature    619..894
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 3"
FT   exon            620..895
FT                   /gene="HLA-B73"
FT                   /number=4
FT   misc_feature    679..849
FT                   /gene="HLA-B73"
FT                   /note="Region: intrachain S-S"
FT   misc_feature    895..927
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 4"
FT   exon            896..1021
FT                   /gene="HLA-B73"
FT                   /number=5
FT   misc_feature    928..1002
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 5"
FT   misc_feature    954
FT                   /gene="HLA-B73"
FT                   /note="2 codon deletion in the canonical HLA transmembrane
FT                   sequence"
FT   misc_feature    961..963
FT                   /gene="HLA-B73"
FT                   /note="3 codons inserted in the canonical HLA transmembrane
FT                   sequence"
FT   misc_feature    1003..1089
FT                   /gene="HLA-B73"
FT                   /note="Region: domain 6"
FT   exon            1022..1057
FT                   /gene="HLA-B73"
FT                   /note="6"
FT   exon            1058..1101
FT                   /gene="HLA-B73"
FT                   /note="7"
XX
SQ   Sequence 1101 BP; 218 A; 338 C; 369 G; 176 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttccaca cctccgtgtc ccggcctggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tgcaaggcca aggcacagac tgaccgagtg       300
     ggcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca cacttggcag       360
     acgatgtatg gctgcgacat ggggccggac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gacacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agaacagaga       840
     tacacgtgcc atgtgcagca cgaggggctg caggagccct gcaccctgag atggaagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt ccttgtggtc       960
     accgtagctg tggtcgctgt ggtcgctgct gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctactctca ggctgcgtcc agcgacagtg cccagggctc tgatgtgtct      1080
     ctcacagctt gaaaagcctg a                                                1101
//


spacer
spacer