spacer

EBI Dbfetch

ID   L23963; SV 1; linear; genomic DNA; STD; HUM; 220 BP.
XX
AC   L23963;
XX
DT   10-SEP-1993 (Rel. 36, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class II HLA-DR-beta cell surface glycoprotein, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-220
RX   DOI; 10.1111/j.1399-0039.1994.tb02404.x.
RX   PUBMED; 7878660.
RA   Fan L.A., Smith A.G., Chandanayingyong D., Hansen J.A.;
RT   "DRB1*1504 (DR2Dai): a new DR2 allele identified in the Dai minority
RT   population of southwest China";
RL   Tissue Antigens 44(5):326-328(1994).
XX
DR   MD5; c55342f53ec83d392be42a4dd3d0a1fe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..220
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR2"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>200
FT                   /codon_start=1
FT                   /product="MHC class II HLA-DR-beta cell surface
FT                   glycoprotein"
FT                   /db_xref="GOA:Q29830"
FT                   /db_xref="IMGT/HLA:DRB1*15:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29830"
FT                   /protein_id="AAA67123.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDFLEQARAAVDTYC"
XX
SQ   Sequence 220 BP; 43 A; 53 C; 84 G; 40 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caggaggagt ccgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg acgctgagta ctggaacagc cagaaggact tcctggagca ggcgcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg                             220
//


spacer
spacer