spacer

EBI Dbfetch

ID   L23534; SV 1; linear; genomic DNA; STD; HUM; 257 BP.
XX
AC   L23534;
XX
DT   25-SEP-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human HLA-DRB1 gene, exon 2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-257
RX   DOI; 10.1111/j.1399-0039.1994.tb02298.x.
RX   PUBMED; 8023320.
RA   Yunis J.J., Kineke E., Yunis E.J.;
RT   "Characterization of a new DRB1 allele, DRB1*1309, by PCR-SSOP and
RT   sequencing";
RL   Tissue Antigens 43(1):54-57(1994).
XX
DR   MD5; cba605bf4b4819a66c795188271dc9cd.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..257
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Patient MJD"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /haplotype="HLA-A26, B14, DRB1*07, DRB4*0101, DQA1*0201,
FT                   DQB1*0201 HLA-A31, B35, Cw1, DRB1*13YUN, DRB3*02,
FT                   DQA1*0103, DQB1*0603"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..257
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="G00-120-642"
FT   CDS             <1..>257
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAA62591.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVT
FT                   ELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV"
XX
SQ   Sequence 257 BP; 54 A; 61 C; 92 G; 50 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttccata accaggagga gaacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca gccagaagga       180
     catcctggag caggcgcggg ccgcggtgga cacctactgc agacacaact acggggttgt       240
     ggagagcttc acagtga                                                      257
//


spacer
spacer