spacer

EBI Dbfetch

ID   L21755; SV 1; linear; genomic DNA; STD; HUM; 235 BP.
XX
AC   L21755;
XX
DT   23-JUL-1993 (Rel. 36, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DRB1*14 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-235
RX   DOI; 10.1007/BF00189242.
RX   PUBMED; 8168862.
RA   Pando M., Theiler G., Melano R., Petzl-Erler M.L., Satz M.L.;
RT   "A new HLA-DR6 allele (DRB1*1413) found in a tribe of Brazilian Indians";
RL   Immunogenetics 39(5):377-377(1994).
XX
DR   MD5; 743b8ac76c22949aa1a8e80e2ac39086.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..235
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /strain="Guarani Indian (Brasil)"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-DR6."
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..235
FT                   /gene="HLA-DRB14"
FT   CDS             <1..>235
FT                   /codon_start=1
FT                   /gene="HLA-DRB14"
FT                   /product="MHC class II HLA-DR-beta"
FT                   /note="sequence from codon 9 to codon 86 from a new
FT                   HLA-DRB1*14 allele. Differs from DRB1*1402 only in codon 57
FT                   (GAT -->AGC); putative"
FT                   /db_xref="GOA:Q29906"
FT                   /db_xref="IMGT/HLA:DRB1*14:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29906"
FT                   /protein_id="AAA58657.1"
FT                   /translation="EYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTEL
FT                   GRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVG"
XX
SQ   Sequence 235 BP; 50 A; 57 C; 88 G; 40 T; 0 other;
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggag        60
     agatacttcc ataaccagga ggagaacgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctagcgcc gagtactgga acagccagaa ggacctcctg       180
     gagcagaggc gggccgcggt ggacacctac tgcagacaca actacggggt tggtg            235
//


spacer
spacer