spacer

EBI Dbfetch

ID   L20777; SV 1; linear; genomic DNA; STD; HUM; 241 BP.
XX
AC   L20777; M99048;
XX
DT   15-APR-1994 (Rel. 39, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 24)
XX
DE   Human MHC class I HLA-G gene (HLA-A33,B14,DR1), exon 2.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-241
RX   DOI; 10.1073/pnas.84.24.9145.
RX   PUBMED; 3480534.
RA   Geraghty D.E., Koller B.H., Orr H.T.;
RT   "A human major histocompatibility complex class I gene that encodes a
RT   protein with a shortened cytoplasmic segment";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(24):9145-9149(1987).
XX
RN   [2]
RP   1-241
RX   PUBMED; 2295808.
RA   Ellis S.A., Palmer M.S., McMichael A.J.;
RT   "Human trophoblast and the choriocarcinoma cell line BeWo express a
RT   truncated HLA Class I molecule";
RL   J. Immunol. 144(2):731-735(1990).
XX
RN   [3]
RP   1-241
RX   DOI; 10.1093/nar/18.8.2189.
RX   PUBMED; 2336406.
RA   Shukla H., Swaroop A., Srivastava R., Weissman S.M.;
RT   "The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted
RT   pattern of expression";
RL   Nucleic Acids Res. 18(8):2189-2189(1990).
XX
RN   [4]
RP   1-241
RX   DOI; 10.1016/0198-8859(91)90026-6.
RX   PUBMED; 1890021.
RA   Zemmour J., Parham P.;
RT   "HLA class I nucleotide sequences, 1991";
RL   Hum. Immunol. 31(3):195-206(1991).
XX
RN   [5]
RP   1-241
RX   DOI; 10.1016/0198-8859(91)90106-J.
RX   PUBMED; 1744000.
RA   Pook M.A., Woodcock V., Tassabehji M., Campbell R.D., Summers C.W.,
RA   Taylor M., Strachan T.;
RT   "Characterization of an expressible nonclassical class I HLA gene";
RL   Hum. Immunol. 32(2):102-109(1991).
XX
RN   [6]
RP   1-241
RX   DOI; 10.1007/BF00210473.
RX   PUBMED; 8102125.
RA   Morales P., Corell A., Martinez-Laso J., Martin-Villa J.M., Varela P.,
RA   Paz-Artal E., Allende L.M., Arnaiz-Villena A.;
RT   "Three new HLA-G alleles and their linkage disequilibria with HLA-A";
RL   Immunogenetics 38(5):323-331(1993).
XX
DR   MD5; fc9f353add925b621efb350dd570ccd4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..241
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A33,B14,DR1"
FT                   /dev_stage="mature"
FT                   /cell_line="homozygous-typing cell"
FT                   /cell_type="EBV-transformed B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>241
FT                   /codon_start=2
FT                   /product="class I outer membrane protein"
FT                   /note="exon 2"
FT                   /db_xref="GOA:Q30170"
FT                   /db_xref="IMGT/HLA:G*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q30170"
FT                   /citation=[1]
FT                   /citation=[4]
FT                   /citation=[3]
FT                   /citation=[2]
FT                   /citation=[5]
FT                   /protein_id="AAB59351.1"
FT                   /translation="AVSRPGRGEPRFIAMGYVDDSQFVRFDSDSACPRMEPRAPWVEQE
FT                   GPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEA"
FT   variation       62
FT                   /replace="a"
XX
SQ   Sequence 241 BP; 48 A; 75 C; 89 G; 29 T; 0 other;
     cgccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga        60
     ctcgcagttc gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc       120
     gtgggtggag caggaggggc cggagtattg ggaagaggag acacggaaca ccaaggccca       180
     cgcacagact gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc       240
     c                                                                       241
//


spacer
spacer