Dbfetch

ID   L14852; SV 1; linear; genomic DNA; STD; HUM; 235 BP.
XX
AC   L14852;
XX
DT   28-APR-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II HLA-DRB1*16X8 gene, exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-235
RX   DOI; 10.1111/j.1399-0039.1994.tb02335.x.
RX   PUBMED; 8085262.
RA   Laforet M., Urlacher A., Tongio M.M.;
RT   "A new HLA DR16 allele (DRB1*1604) with a short DR8 sequence";
RL   Tissue Antigens 43(4):257-260(1994).
XX
DR   MD5; c667797c4d85b76903546dcaef1e56a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..235
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   exon            1..235
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="first domain of the second exon; sequence codes for
FT                   a new DRB1 allele"
FT   gene            1..235
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>235
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /db_xref="GOA:Q29786"
FT                   /db_xref="IMGT/HLA:DRB1*16:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29786"
FT                   /protein_id="AAC37561.1"
FT                   /translation="WQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTEL
FT                   GRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVG"
XX
SQ   Sequence 235 BP; 50 A; 55 C; 88 G; 42 T; 0 other;
     tggcagccta agagggagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggac        60
     agatacttct ataaccagga ggagtccgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctgacgct gagtactgga acagccagaa ggacttcctg       180
     gaagacaggc gggccctggt ggacacctac tgcagacaca actacggggt tggtg            235
//