Dbfetch

ID   L14481; SV 1; linear; genomic DNA; STD; HUM; 221 BP.
XX
AC   L14481;
XX
DT   10-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens MHC class II HLA-DRB1 O4SAM allele gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-221
RX   DOI; 10.1007/BF00184531.
RX   PUBMED; 8406622.
RA   Zhang S., Fernandez-Vina M., Falco M., Cerna M., Raimondi E., Stastny P.;
RT   "A novel HLA-DRB1 allele (DRB1*0417) in South American Indians";
RL   Immunogenetics 38(6):463-463(1993).
XX
DR   MD5; 0858eb8b80011aa4ca283a0548f9fd25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..221
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-DRB1*04SAM"
FT                   /cell_type="Leukocyte"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   gene            1..221
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>221
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="lymphocyte antigen DRB1"
FT                   /db_xref="GOA:Q07122"
FT                   /db_xref="IMGT/HLA:DRB1*04:17:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q07122"
FT                   /protein_id="AAB59623.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSA
FT                   EYWNSQKDLLEQRRAEVDTYCRHNYGVG"
FT   variation       219..221
FT                   /gene="HLA-DRB1"
FT                   /replace="ggt"
FT                   /note="'ggt' in allele at codon 86; G00-120-642"
XX
SQ   Sequence 221 BP; 48 A; 54 C; 82 G; 37 T; 0 other;
     atgagtgtca tttcttcaac gggacggagc gggtgcggtt cctggacaga tacttctatc        60
     accaagagga gtacgtgcgc ttcgacagcg acgtggggga gtaccgggcg gtgacggagc       120
     tggggcggcc tagcgccgag tactggaaca gccagaagga cctcctggag cagaggcggg       180
     ccgaggtgga cacctactgc agacacaact acggggttgg t                           221
//