Dbfetch

ID   L09236; SV 1; linear; unassigned DNA; STD; HUM; 242 BP.
XX
AC   L09236;
XX
DT   16-NOV-1993 (Rel. 37, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II HLA-DPB1 (allele DPB1*4501) gene, exon 2 partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane glycoprotein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1993.tb02015.x.
RX   PUBMED; 8236237.
RA   de Vries N., Meijerink J.P., Tijssen H., Demas M., Mensink E.J.,
RA   van de Putte L.B.;
RT   "A novel HLA-DPB1 allele (DPB1*4501) in a Dutch Caucasian healthy control";
RL   Tissue Antigens 41(5):255-258(1993).
XX
DR   MD5; 7dddc9bebfb30a0b72b1ad732ce382a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..242
FT                   /organism="Homo sapiens"
FT                   /strain="Caucasian"
FT                   /mol_type="unassigned DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>242
FT                   /number=2
FT   CDS             <1..>242
FT                   /codon_start=3
FT                   /product="HLA-DPB1"
FT                   /note="allele DPB1*NM/DPB1*4501 (Dutch Caucasian)"
FT                   /db_xref="GOA:Q29964"
FT                   /db_xref="IMGT/HLA:DPB1*45:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29964"
FT                   /protein_id="AAA16928.1"
FT                   /translation="LRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQ"
XX
SQ   Sequence 242 BP; 57 A; 57 C; 91 G; 37 T; 0 other;
     agttacggca ggaatgctac gcgtttaatg ggacacagcg cttcctggag agatacatct        60
     acaaccggga ggagttcgtg cgcttcgaca gcgacgtggg ggagttccgg gcggtgacgg       120
     agctggggcg gcctgatgag gagtactgga acagccagaa ggacctcctg gaggagaagc       180
     gggcagtgcc ggacagggta tgcagacaca actacgagct ggacgaggcc gtgaccctgc       240
     ag                                                                      242
//