Dbfetch

ID   L07767; SV 1; linear; genomic DNA; STD; HUM; 223 BP.
XX
AC   L07767;
XX
DT   12-DEC-1992 (Rel. 34, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human major histocompatibility complex class II (HLA-DRB1) gene, partial
DE   cds.
XX
KW   beta chain; cell surface glycoprotein; class II gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-223
RA   Buyse I., Marynen P., Cassiman J.J.;
RT   "Identification of new class II HLA DRB1, DRB4 and DPB1 alleles in the
RT   Belgian population";
RL   Unpublished.
XX
DR   MD5; 9a74987587aaee8c9a04cd56a4e6e51b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..223
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /haplotype="DRB1, DRB4, DRP1"
FT                   /tissue_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>223
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="major histocompatibility complex class II"
FT                   /note="putative"
FT                   /db_xref="GOA:O19696"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19696"
FT                   /protein_id="AAA59689.1"
FT                   /translation="SECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPD
FT                   AEYWNSQKDLLEQKRGRVDNYCRHNYGVV"
XX
SQ   Sequence 223 BP; 49 A; 51 C; 84 G; 39 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg tacctggaca gatacttcca        60
     taaccaggag gagaacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgccg agtactggaa cagccagaag gacctcctgg agcagaagcg       180
     gggccgggtg gacaattact gcagacacaa ctacggggtt gtg                         223
//