Dbfetch

ID   L06440; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   L06440;
XX
DT   09-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human lymphocyte antigen A33 mRNA, complete cds.
XX
KW   lymphocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1111/j.1399-0039.1993.tb02006.x.
RX   PUBMED; 8362415.
RA   Kato N., Kikuchi A., Kano K., Egawa K., Takiguchi M.;
RT   "Molecular analysis of a novel HLA-A33 subtype associated with HLA-B44";
RL   Tissue Antigens 41(4):211-213(1993).
XX
DR   MD5; 2bcac5063d7363db33010fbbe2c9b0a2.
XX
CC   On Feb 9, 1994 this sequence version replaced gi:453647.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /isolate="IT"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="A2,A33,B44,B39.1,CW7,CX4451"
FT                   /cell_type="peripheral blood lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /db_xref="GOA:P16190"
FT                   /db_xref="H-InvDB:HIT000191712.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*33:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16190"
FT                   /protein_id="AAA71914.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            1..74
FT                   /note="label:exon1"
FT   exon            75..343
FT                   /note="label:exon2"
FT   exon            344..619
FT                   /note="label:exon3"
FT   exon            620..895
FT                   /note="label:exon4"
FT   exon            896..1012
FT                   /note="label:exon5"
FT   exon            1013..1045
FT                   /note="label:exon6"
FT   exon            1046..1089
FT                   /note="label:exon7"
FT   exon            1090..1098
FT                   /note="label:exon8"
XX
SQ   Sequence 1098 BP; 217 A; 330 C; 366 G; 185 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg ccggctccca ctccatgagg tatttcacca catccgtgtc ccggcccggc       120
     agtggagagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacggaat gtgaaggccc actcacagat tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctagttct ctttggagct       960
     gtgttcgctg gagctgtggt cgctgctgtg aggtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//