Dbfetch

ID   KX687303; SV 1; linear; genomic DNA; STD; HUM; 4304 BP.
XX
AC   KX687303;
XX
DT   23-AUG-2017 (Rel. 133, Created)
DT   23-AUG-2017 (Rel. 133, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*04:01:01:01e1 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4304
RA   Barsakis K., Babrzadeh F., Chi A., Mindrinos M.N., Fernandez-Vina M.A.;
RT   "HLA variation in coding and non-coding gene segments";
RL   Unpublished.
XX
RN   [2]
RP   1-4304
RA   Barsakis K., Babrzadeh F., Chi A., Mindrinos M.N., Fernandez-Vina M.A.;
RT   ;
RL   Submitted (09-AUG-2016) to the INSDC.
RL   Stanford Blood Center, Stanford School of Medicine, 3165 Porter Drive, Palo
RL   Alto, CA 94304, USA
XX
DR   MD5; 82240abb734b2c1146544acfdfb1e76d.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Program in house v. k1.1
CC   Sequencing Technology :: Illumina; Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4304
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <496..>3390
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04:01:01:01e1"
FT   mRNA            join(<496..568,699..968,1215..1490,2078..2353,2475..2594,
FT                   3034..3066,3174..3221,3386..>3390)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04:01:01:01e1"
FT                   /product="MHC class I antigen"
FT   CDS             join(496..568,699..968,1215..1490,2078..2353,2475..2594,
FT                   3034..3066,3174..3221,3386..3390)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04:01:01:01e1"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5D1W8"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D1W8"
FT                   /protein_id="ASU06326.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 4304 BP; 835 A; 1198 C; 1300 G; 971 T; 0 other;
     ttattttgct ggatgtagtt taatattacc tgaggtaagg taaggcaaag agtgggaggc        60
     agggagtcca gttcagggac ggggattcca ggagaagtga aggggaaggg gctgggcgca       120
     gcctgggggt ctctccctgg tttccacaga cagatccttg gccaggactc aggcacacag       180
     tgtgacaaag atgcttggtg taggagaaga ggaatcagga cgaagtccca ggtcccgggc       240
     ggggctctca gggtctcagg ctccaagggc cgtgtctgca ctggggaggc gccgcgttgg       300
     ggattctcca ctcccctgag tttcacttct tctcccaacc tgcgtcgggt ccttcttcct       360
     gaatactcat gacgcgtccc caattcccac tcccattggg tgtcgggttc tagagaagcc       420
     aatcagcgtc tccgcagtcc cggttctaaa gtccccagtc acccacccgg actcagattc       480
     tccccagacg ccgagatgcg ggtcatggcg ccccgaaccc tcatcctgct gctctcggga       540
     gccctggccc tgaccgagac ctgggccggt gagtgcgggg ttgggaggga aacggcctct       600
     ggggagagga gcgaggggcc cgcccggcga gggcgcagga cccggggagc cgcgcaggga       660
     ggagggtcgg gcgggtctca gccactcctc gtccccaggc tcccactcca tgaggtattt       720
     ctccacatcc gtgtcctggc ccggccgcgg ggagccccgc ttcatcgcag tgggctacgt       780
     ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agtccaagag gggagccgcg       840
     ggagccgtgg gtggagcagg aggggccgga gtattgggac cgggagacac agaagtacaa       900
     gcgccaggca caggctgacc gagtgaacct gcggaaactg cgcggctact acaaccagag       960
     cgaggacggt gagtgacccc ggcccggggc gcaggtcacg acccctcccc atcccccacg      1020
     gacggcccgg gtcgccccga gtctccccgt ctgagatcca ccccgaggct gcggaacccg      1080
     cccagaccct cgaccggaga gagccccagt cacctttacc cggtttcatt ttcagtttag      1140
     gccaaaatcc ccgcgggttg gtcgggactg gggcggggct cgggggaccg ggctgaccac      1200
     gggggcgggg ccagggtctc acaccctcca gaggatgttt ggctgcgacc tggggccgga      1260
     cgggcgcctc ctccgcgggt ataaccagtt cgcctacgac ggcaaggatt acatcgccct      1320
     gaacgaggat ctgcgctcct ggaccgccgc ggacacggcg gctcagatca cccagcgcaa      1380
     gtgggaggcg gcccgtgagg cggagcagcg gagagcctac ctggagggca cgtgcgtgga      1440
     gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg      1500
     cagtggggag ccttccccat ctcccgtaga tctcccggga tggcctccca cgaggagggg      1560
     aggaaaatgg gatcagcgct agaatatcgc cctcccttga atggagaatg ggatgagttt      1620
     tcctgagttt cctctgaggg ccccctctgc tctctaggac aattaaggga tgaagtcctt      1680
     gaggaaatgg aggggaagac agtccctgga atactgatca ggggtcccct ttgaccactt      1740
     tgaccactgc agcagctgtg gtcaggctgc tgacctttct ctcaggcctt gttctctgcc      1800
     tgacgctcaa tgtgtttgaa ggtttgattc cagcttttct gagtccttcg gcctccactc      1860
     aggtcaggac cagaagtcgc tgttcctccc tcagagacta gaactttcca atgaatagga      1920
     gattatccca ggtgcctgtg tccaggctgg cgtctgggtt ctgtgccccc ttccccaccc      1980
     caggtgtcct gtccattctc aggatggtca catgggcgct gttggagtgt cgcaagagag      2040
     atacaaagtg tctgaatttt ctgactcttc ccatcagaac acccaaagac acacgtgacc      2100
     caccatcccg tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct      2160
     gcggagatca cactgacctg gcagtgggat ggggaggacc aaactcagga caccgagctt      2220
     gtggagacca ggccagcagg agatggaacc ttccagaagt gggcagctgt ggtggtgcct      2280
     tctggagaag agcagagata cacgtgccat gttcagcacg aggggctgcc ggagcccctc      2340
     accctgagat ggagtaagga gggggatgag gggtgatgtg tcttctcagg gaaagcagaa      2400
     gtcctggagc ccttcagccg ggtcagggct gaggcttgga ggtcagggcc cctcaccttc      2460
     ccctcctttc ccagagccgt cttcccagcc caccatcccc atcgtgggca tcgttgctgg      2520
     cctggctgtc ctggctgtcc tagctgtcct aggagctatg gtggctgttg tgatgtgtag      2580
     gaggaagagc tcaggtaggg aaggggtgag gagtggggtc tgggttttct tgttccactg      2640
     ggagtttcaa gccccaggta gaagtgtgcc ccacctcgtt actggaagca ccatccacac      2700
     atgggccatc ccagcctggg accctgtgtg ccagcactta ctctgttgtg aagcacatga      2760
     caatgaagga cagatgtatc accttgatga ttatggtgtt ggggtccttg attccagcat      2820
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tgcttcagaa      2880
     cccacagctg ctttccccgt gtttcctgat cctgccctgg gtctgcagtc atagttctgg      2940
     aaacttctct tgggtccaag actaggaggt tcccctaaga tcgcatggcc ctgcctcctc      3000
     cctgtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tgctctcagg      3060
     ctgcgtgtaa gtgatggcgg tgggcgtgtg gaggagctca cccaccccat aattcctctt      3120
     gtcccacatc tcctgcgggc tctgaccagg tctttttttt tgttctaccc cagccagcaa      3180
     cagtgcccag ggctctgatg agtctctcat cgcttgtaaa ggtgagattc tggggagctg      3240
     aagtggtcgg gggtggggca gagggaaaag gcctaggtaa tggggatcct ttgattggga      3300
     cgtttcgaat gtgtggtgag ctgttcagag tgtcatcact taccatgact gacctgaatt      3360
     tgttcatgac tattgtgttc tgtagcctga gacagctgcc tgtgtgggac tgagatgcag      3420
     gatttcttca cacctctcct ttgtgacttc aagagcctct ggcatctctt tctgcaaagg      3480
     catctgaatg tgtctgcgtt cctgttagca taatgtgagg aggtggagag acagcccacc      3540
     cccgtgtcca ccgtgacccc tgtccccaca ctgacctgtg ttccctcccc gatcatcttt      3600
     cctgttccag agaagtgggc tggatgtctc catctctgtc tcaacttcat ggtgcgctga      3660
     gctgcaactt cttacttccc taatgaagtt aagaacctga atataaattt gttttctcaa      3720
     atatttgcta tgaagggttg atggattaat taaataagtc aattcctgga agttgagaga      3780
     gcaaataaag acctgagaac cttccagaat ccgcatgttc gctgtgctga gtctgttgca      3840
     ggtgggggtg gggaaggctg tgaggagccg agtgtggacg gggcctgtgc ctagttgctg      3900
     ttcagttctt catgggcttt atgtggtcag tcctcagctg ggtcaccttc actgctccat      3960
     tgtccttgtc ccttcagtgg aaacttgtcc agcgggagct gtgaccacag aggctcacac      4020
     atcgcccagg gcagcccctg cacacgggag tccctgtgct ttctgagaca aattttcaga      4080
     cccattcagc tcctgccctc cttctagggc tcctcttctg ctttggtctc ctgccctctc      4140
     tcccttccct gattccagtg atcttcgtgc tgactccaat cccaactcat gaatctaaag      4200
     cagagcctaa tttagattta tatttgtttg taaaattggg tccatagtct agaattgttc      4260
     cttcctgaag agagaaacct gattgtgtgc tgcagtgtgt gggg                       4304
//