Dbfetch

ID   KJ920279; SV 1; linear; genomic DNA; STD; HUM; 1301 BP.
XX
AC   KJ920279;
XX
DT   23-JUL-2014 (Rel. 121, Created)
DT   23-JUL-2014 (Rel. 121, Last updated, Version 1)
XX
DE   Homo sapiens isolate 2012TB666 MHC class II antigen gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1301
RA   Zhuo X., Wang L., Chen L.;
RT   "Sequence analysis of a novel human leukocyte antigen allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1301
RA   Zhuo X., Wang L., Chen L.;
RT   ;
RL   Submitted (14-MAY-2014) to the INSDC.
RL   College of Medical Technology and Engineering, Shanghai Tissuebank
RL   Biotechnology Co., Ltd, Block 1010, Zobon Business Park, No. 999 Wangqiao
RL   Rd, Pudong Nd, Shanghai, Shanghai 201201, China
XX
DR   MD5; 4815a82c65a14adc4bc77277aa0e0dc5.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1301
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="2012TB666"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /collection_date="13-Aug-2013"
FT                   /cell_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..100,201..470,571..852,953..1063,1164..1187,
FT                   1288..>1301)
FT                   /product="MHC class II antigen"
FT   CDS             join(1..100,201..470,571..852,953..1063,1164..1187,
FT                   1288..1301)
FT                   /codon_start=1
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0A075M2N1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A075M2N1"
FT                   /protein_id="AIF74584.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLKQDKFECH
FT                   FFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAVTELGRPVAKSWNSQKDFLERRRAEV
FT                   DTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   gap             101..200
FT                   /estimated_length=unknown
FT   gap             471..570
FT                   /estimated_length=unknown
FT   gap             853..952
FT                   /estimated_length=unknown
FT   gap             1064..1163
FT                   /estimated_length=unknown
FT   gap             1188..1287
FT                   /estimated_length=unknown
XX
SQ   Sequence 1301 BP; 173 A; 200 C; 263 G; 165 T; 500 other;
     atggtgtgtc tgaagctccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccaac nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn cacgtttctt gaagcaggat aagtttgagt gtcatttctt       240
     caacgggacg gagcgggtgc ggtatctgca cagaggcatc tataaccaag aggagaacgt       300
     gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc       360
     caagtcctgg aacagccaga aggacttcct ggagcggagg cgggccgagg tggacaccgt       420
     gtgcagacac aactacgggg ttggtgagag cttcacagtg cagaggcgag nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tccatcctga ggtgactgtg tatcctgcca       600
     agactcagcc cctgcagcac cacaacctcc tggtctgctc tgtgagtggt ttctatccag       660
     gcagcattga agtcaggtgg ttccggaacg gccaggaaga gaaggctggg gtggtgtcca       720
     caggcctgat ccagaatgga gactggacct tccagaccct ggtgatgctg gaaacagttc       780
     ctcggagtgg agaagtttac acctgccaag tggagcaccc aagtgtgatg agccctctca       840
     cagtggaatg gannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngagcacgg       960
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc      1020
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aagnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnngacactc tggacttcag ccaacagnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnngat tcctgagctg a                          1301
//