Dbfetch

ID   KJ562278; SV 1; linear; genomic DNA; STD; HUM; 3343 BP.
XX
AC   KJ562278;
XX
DT   27-MAY-2014 (Rel. 120, Created)
DT   27-MAY-2014 (Rel. 120, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*17 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3343
RA   de Hoop T.A.;
RT   "Next generation sequencing of new HLA alleles, unconfirmed alleles, and
RT   unidentified exons and introns";
RL   Unpublished.
XX
RN   [2]
RP   1-3343
RA   de Hoop T.A.;
RT   ;
RL   Submitted (11-MAR-2014) to the INSDC.
RL   Immunology, UMC Utrecht, Heidelberglaan 100, Utrecht 3584CX, The
RL   Netherlands
XX
DR   MD5; 04e0a938ea1fe92abe3e5a5c97836500.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: NGSengine v. 1.3.0.1457
CC   Assembly Name         :: 55131
CC   Coverage              :: 570
CC   Sequencing Technology :: Illumina
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3343
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <283..>3197
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17"
FT   mRNA            join(<283..355,486..755,1002..1277,1865..2140,2265..2402,
FT                   2841..2873,2981..3028,3193..>3197)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17"
FT                   /product="MHC class I antigen"
FT   CDS             join(283..355,486..755,1002..1277,1865..2140,2265..2402,
FT                   2841..2873,2981..3028,3193..3197)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:I2G9F9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:I2G9F9"
FT                   /protein_id="AIA09920.1"
FT                   /translation="MRVMAPQALLLLLSGALALIETWTGSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAVLAVLAVLAVLGAVVAAVIHR
FT                   RKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 3343 BP; 620 A; 977 C; 1044 G; 702 T; 0 other;
     gatcaggacg aagtcccagg tcccgggcgg ggctctctgg gtctcaagct cccagggccg        60
     tgtctgcatt ggggaggcgc agcgttgggg attccccact cccactcccc tgagtttcac       120
     ttcttctccc aacctgcgtc gggtccttct tcctgaatac tcatgacgcg tccccaattc       180
     ccactcccat tgggtgtcgg gttctagaga agccaatcag cgtctacgca gtcccggttc       240
     tgaagtcacc cacccggact cagattctcc ccagacgccg agatgcgggt catggcgccc       300
     caagccctcc tcctgctgct ctcgggagcc ctggccctga tcgagacctg gaccggtgag       360
     tgcggggttg ggagggaaac ggcctctgcg gagaggagcg aggggcccgc ccggcgaggg       420
     cgcaggaccc ggggagccgc gcagggagga gggtcgggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcta caccgccgtg tcccggcccg gccgcggaga       540
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga       600
     cgccgcgagt ccgagagggg agccgcgggc gccgtgggtg gagcaggagg ggccggagta       660
     ttgggaccgg gagacacaga agtacaagcg ccaggcacag gctgaccgag tgaacctgcg       720
     gaaactgcgc ggctactaca accagagcga ggccggtgag tgaccccagc ccggggcgca       780
     ggtcacgacc cctccccatc ccccacggac ggcccgggtc gccccgagtc tcccggtctg       840
     agatcctccc cgaggctgcg gaacccgccc agaccctcga ccggagagag ccctagtcgc       900
     ctttacccgg tttcattttc agtttaggcc aaaatccccg cgggttggtc ggggctgggg       960
     cggggctcgg gggacggggc tgaccacggg ggcggggcca ggttctcaca ccatccagag      1020
     gatgtatggc tgcgacctgg ggcccgacgg gcgcctcctc cgcgggtata accagttcgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgcggcgga      1140
     cacggcggct cagatctccc agcgcaagtt ggaggcggcc cgtgaggcgg agcagctgag      1200
     agcctacctg gagggcgagt gcgtggagtg gctccgcgga tacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctatagatct      1320
     cccgggatgg cctcccacga ggaggggagg aaaatgggat cagcgctaga atatcgccct      1380
     cccttgaatg gagaatggga tgagttttcc cgagtttcct ctgagggccc cgtctgctct      1440
     ctaggacaat taagggatga agtccctgag gaaatggagg ggaagacagt ccctggaata      1500
     ctgatcaggg gtcccctttg accactttga ccactgcggc agctgtggtc aggctgctga      1560
     cctttctctc aggccttgtt ctctgcctca cactcaatgt gtctgaaggt ttgattccag      1620
     cttttctgag tccttcggcc tccactcagg tcaggaccag aagtcgctgt tcctccctca      1680
     gagactagaa ctttccaaag aataggagat tatcccaggt ccctgtgtcc aggctggcgt      1740
     ctgggttctg tgcccccttc cctaccccag gtgtcctgtc cattctcagg atggtcacat      1800
     gggcgctgct ggagtgtcgc aagagagata caaagtgtct gaattttctg actcttcccg      1860
     tcagaacgcc caaagacaca cgtgacccac catcccgtct ctgaccatga ggccaccctg      1920
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggg      1980
     gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc cagcaggaga tggaaccttc      2040
     cagaagtggg cagctgtggt ggtgccttct ggacaagaac agagatacac gtgccatgtg      2100
     cagcacgagg ggctgcagga gccctgcacc ctgagatgga gtaaggaggg ggatgagggg      2160
     tcatgtgtct tctcagggaa agcagaagtc cttctggagc ccttcagccg ggtcagggct      2220
     gaggcttggg tgtaagggcc cctcaccttc ccctcctttc ccagagccgt cttcccagcc      2280
     caccatcccc aacttgggca tcgtttctgg cccagctgtc ctggctgtcc tggctgtcct      2340
     ggctgtccta gctgtcctag gagctgtggt cgctgctgtg atacatagga ggaagagctc      2400
     aggtagggaa ggggtgagga gtggggtctg ggttttcttg tcccactggg agtttcaagc      2460
     cccaggtaga agtgtgcccc acctcgttac tggaagcacc atccacacct gggccatccc      2520
     agcctgggac cctgtgtgcc agcacttact ctgttgtgaa gcacatgaca acgaaggaca      2580
     gatgtatcac cttgatgatt atggtgttgg ggtcctgatt ccagcattcg tgagtcaggg      2640
     gaaggtccct gctaaggaca gaccttagga gggcagttgc tccagaaccc acagctgctt      2700
     tccccgtgtt tcctgatcct gccctgggtc tgcagtcata gttctggaaa cttctcttgg      2760
     gtccaagact aggaggttcc cctaagatcg catggccctg cctcctccct gtcccctcac      2820
     agggcatttt cttcccacag gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg      2880
     atggcggtgg gcgtgtggag gagctcacct accccataat tcctcttgtc ccacatctcc      2940
     tgcgggctct gaccaggtct ttttttttgt tctaccccag ccagcaacag tgcccagggc      3000
     tctgatgagt ctctcatcgc ttgtaaaggt gagattctgg ggagctgaag tggtcggggg      3060
     tggggcagag ggaaaaggcc tgggtaatgg ggatcctttg attgggacgt ttcgagtgtg      3120
     tggtggactg ttcagagtgt catcacttac catgactgac ctgaatttgt tcatgactat      3180
     tgtgttctgt agcctgagac agctgcctgt gtgggactga gatgcaggat ttcttcacac      3240
     ctctcctttg tgacttcaag agcctctggc atctctttct gcaaaggcat ctgaatgtgt      3300
     ctgcgttcct gttagcataa tgtgaggagt tggagagaca gct                        3343
//