spacer

EBI Dbfetch

ID   KC296455; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   KC296455;
XX
DT   27-JUN-2013 (Rel. 117, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 (HLA-DRB1) gene, HLA-DRB1*15:02:01 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Brooks C., Hurley C.K.;
RT   ;
RL   Submitted (10-DEC-2012) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 47a9d8e634f7fde6a14930bdcc5acdcf.
DR   IMGT/HLA; DRB1*15:02:10; HLA09107.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:02:01 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:02:01 variant"
FT                   /product="HLA-DRB1"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:02:01 variant"
FT                   /product="HLA-DRB1"
FT                   /db_xref="GOA:R9WRP1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:R9WRP1"
FT                   /protein_id="AGO03666.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 56 A; 66 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg agcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer