spacer

EBI Dbfetch

ID   KC256922; SV 1; linear; genomic DNA; STD; HUM; 790 BP.
XX
AC   KC256922;
XX
DT   12-MAR-2013 (Rel. 116, Created)
DT   12-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*18:01:01:01 allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-790
RA   Lazaro A.M., Chen M., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-790
RA   Lazaro A.M., Chen M., Hurley C.K.;
RT   ;
RL   Submitted (04-DEC-2012) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; a085b3f6582e1b5f7a598638a7826237.
DR   IMGT/HLA; B*18:86; HLA09077.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..790
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>790
FT                   /gene="HLA-B"
FT                   /allele="B*18:01:01:01"
FT   mRNA            join(<1..270,516..>790)
FT                   /gene="HLA-B"
FT                   /allele="B*18:01:01:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>790)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*18:01:01:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:M4MEZ9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:M4MEZ9"
FT                   /protein_id="AGG68134.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGMC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*18:01:01:01"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..790
FT                   /gene="HLA-B"
FT                   /allele="B*18:01:01:01"
FT                   /number=3
XX
SQ   Sequence 790 BP; 110 A; 177 C; 188 G; 70 T; 245 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc atgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg                                                              790
//


spacer
spacer