spacer

EBI Dbfetch

ID   KC238309; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   KC238309;
XX
DT   05-MAR-2013 (Rel. 116, Created)
DT   05-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*04 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Testi M.;
RT   "DQB1*04new is the result of a gene conversion event between a DQB1*04 and
RT   a DQB1*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Testi M.;
RT   ;
RL   Submitted (27-NOV-2012) to the INSDC.
RL   Tor Vergata Hospital, LIBT Fondazione IME, viale Oxford 81, Rome, RM 00133,
RL   Italy
XX
DR   MD5; 7f2eb328124464810ba8d96f37c5b707.
DR   IMGT/HLA; DQB1*04:09; HLA09075.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:M1T1B8"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:M1T1B8"
FT                   /protein_id="AGG35556.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 270 BP; 59 A; 72 C; 94 G; 45 T; 0 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacc gagcgcgtgc        60
     ggggtgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg tggacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer