spacer

EBI Dbfetch

ID   KC172394; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   KC172394;
XX
DT   11-MAR-2013 (Rel. 116, Created)
DT   11-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11:118 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Brooks C., Hurley C.K.;
RT   ;
RL   Submitted (15-NOV-2012) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 65812308a6b0b8105bae3a1bddc54d5d.
DR   IMGT/HLA; A*11:139; HLA09081.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11:118 variant"
FT   mRNA            join(<1..269,511..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11:118 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..269,511..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11:118 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:M4MFB9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:M4MFB9"
FT                   /protein_id="AGG56518.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTLQMMFGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   gap             270..510
FT                   /estimated_length=241
XX
SQ   Sequence 787 BP; 107 A; 165 C; 199 G; 75 T; 241 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer