spacer

EBI Dbfetch

ID   KC171732; SV 1; linear; genomic DNA; STD; HUM; 1254 BP.
XX
AC   KC171732;
XX
DT   26-FEB-2013 (Rel. 115, Created)
DT   26-FEB-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I polypeptide-related sequence A (MICA) gene,
DE   MICA*007:01:var allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1254
RA   Zollikofer C., Fuerst D., Milnikel I., Richter A.;
RT   "A new variant of MICA*007:01";
RL   Unpublished.
XX
RN   [2]
RP   1-1254
RA   Zollikofer C., Fuerst D., Milnikel I., Richter A.;
RT   ;
RL   Submitted (15-NOV-2012) to the INSDC.
RL   IKT Ulm, Transplantation Immunology, Helmholtzstrasse 10, Ulm,
RL   Baden-Wurttemberg 89075, Germany
XX
DR   MD5; e257ac63a84212db10f8bb80a6157415.
DR   IMGT/HLA; MICA*007:06; HLA08961.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1254
FT                   /gene="MICA"
FT                   /allele="MICA*007:01:var"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1254)
FT                   /gene="MICA"
FT                   /allele="MICA*007:01:var"
FT                   /product="MHC class I polypeptide-related sequence A"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1254)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*007:01:var"
FT                   /product="MHC class I polypeptide-related sequence A"
FT                   /note="ligand for NK cell activating receptor NKG2D"
FT                   /db_xref="GOA:M1NVA7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:M1NVA7"
FT                   /protein_id="AGF90793.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   gap             644..743
FT                   /estimated_length=unknown
FT   gap             1023..1122
FT                   /estimated_length=unknown
XX
SQ   Sequence 1254 BP; 242 A; 239 C; 267 G; 206 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngtttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gtgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctatt tttgttatta      1200
     ttattttcta tgtccgttgt tgtaagaaga aaacatcagc tgcagagggt ccag            1254
//


spacer
spacer