spacer

EBI Dbfetch

ID   KC136768; SV 1; linear; genomic DNA; STD; HUM; 1639 BP.
XX
AC   KC136768;
XX
DT   03-FEB-2013 (Rel. 115, Created)
DT   03-FEB-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1639
RA   Lin C.-Y., Chang C.-L.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   Molecular Technology, NTUH, No. 7, Zhongshan S. Rd., Taipei, Taipei 100,
RL   Taiwan
XX
DR   MD5; 489a511ae2ef502229e9fc149d13bc1c.
DR   IMGT/HLA; A*11:134; HLA08930.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1639
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1639
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT   mRNA            join(<1..268,510..785,1365..>1639)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..268,510..785,1365..>1639)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:L7Y4K8"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L7Y4K8"
FT                   /protein_id="AGD91923.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDKQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             269..509
FT                   /estimated_length=241
FT   gap             786..1364
FT                   /estimated_length=579
XX
SQ   Sequence 1639 BP; 170 A; 249 C; 284 G; 116 T; 820 other;
     tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc        60
     ttcatcgccg tgggctacgt ggacgacaag cagttcgtgc ggttcgacag cgacgccgcg       120
     agccagagga tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac       180
     caggagacac ggaatgtgaa ggcccagtca cagactgacc gagtggacct ggggaccctg       240
     cgcggctact acaaccagag cgaggacgnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnng ttctcacacc atccagataa tgtatggctg       540
     cgacgtgggg ccggacgggc gcttcctccg cgggtaccgg caggacgcct acgacggcaa       600
     ggattacatc gccctgaacg aggacctgcg ctcttggacc gcggcggaca tggcagctca       660
     gatcaccaag cgcaagtggg aggcggccca tgcggcggag cagcagagag cctacctgga       720
     gggccggtgc gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg       780
     cacggnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnaccccc ccaagacaca      1380
     tatgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggctt      1440
     ctaccctgcg gagatcacac tgacctggca gcgggatggg gaggaccaga cccaggacac      1500
     ggagctcgtg gagaccaggc ctgcagggga tggaaccttc cagaagtggg cggctgtggt      1560
     ggtgccttct ggagaggagc agagatacac ctgccatgtg cagcatgagg gtctgcccaa      1620
     gcccctcacc ctgagatgg                                                   1639
//


spacer
spacer