Dbfetch

ID   KC119454; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   KC119454;
XX
DT   04-FEB-2013 (Rel. 115, Created)
DT   04-FEB-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03-02 new
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   DeOliveira A., Tian R., Chen D.;
RT   "Identification of HLA-DQB1*03:02 Novel allele";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   DeOliveira A., Tian R., Chen D.;
RT   ;
RL   Submitted (01-NOV-2012) to the INSDC.
RL   Clinical Transplantation Immunology Laboratory, Duke University Medical
RL   Center, Research Parks Building, Room 116, Durham, NC 27710, USA
XX
DR   MD5; ef5bb7f2dec5b0acc806d8dfcaef8aab.
DR   IMGT/HLA; DQB1*03:45; HLA08955.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SeqPilot v. 3.1
CC   Assembly Name         :: 98511
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-02 new"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-02 new"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03-02 new"
FT                   /product="MHC class II antigen"
FT                   /note="EXON 2-3"
FT                   /db_xref="GOA:L7YGV4"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L7YGV4"
FT                   /protein_id="AGD99115.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRADLDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 124 A; 164 C; 164 G; 100 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggact tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc agtgacagat ttctatccag cccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacaactggc gttgtgtcca ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag aaccccatca tcgtggagtg gc               652
//