Dbfetch

ID   KC109818; SV 1; linear; genomic DNA; STD; HUM; 790 BP.
XX
AC   KC109818;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*15 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-790
RA   Rampim G.F., Paula R.A., Echeverria V.F., Gerbase-DeLima M.;
RT   "Identification of a new HLA-B allele in Brazilian population";
RL   Unpublished.
XX
RN   [2]
RP   1-790
RA   Rampim G.F., Paula R.A., Echeverria V.F., Gerbase-DeLima M.;
RT   ;
RL   Submitted (31-OCT-2012) to the INSDC.
RL   Instituto de Imunogenetica - IGEN, Associacao Fundo de Incentivo a Pesquisa
RL   - AFIP, Loefgreen, 1235, Sao Paulo, Sao Paulo 04040-031, Brasil
XX
DR   MD5; 1acd062ff1c9f2e84a126079279017a7.
DR   IMGT/HLA; B*15:265; HLA08926.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: HLA SBT uTYPE v. 6.0
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..790
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood leukocytes"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT   mRNA            join(<1..270,515..>790)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,515..>790)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:L0HNX6"
FT                   /protein_id="AGB07424.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=2
FT   gap             271..514
FT                   /estimated_length=244
FT   exon            515..>790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=3
XX
SQ   Sequence 790 BP; 114 A; 171 C; 189 G; 72 T; 244 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnggtctc acatcatcca gaggatgtat       540
     ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt atgaccagtc cgcctacgac       600
     ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc ggacacggcg       660
     gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagct gagaacctac       720
     ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg       780
     cagcgcgcgg                                                              790
//