spacer

EBI Dbfetch

ID   KC109817; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   KC109817;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Rampim G.F., Paula R.A., Echeverria V.F., Gerbase-DeLima M.;
RT   "Identification of a new HLA-DRB1 allele in Brazilian population";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Rampim G.F., Paula R.A., Echeverria V.F., Gerbase-DeLima M.;
RT   ;
RL   Submitted (04-OCT-2012) to the INSDC.
RL   Instituto de Imunogenetica - IGEN, Associacao Fundo de Incentivo a Pesquisa
RL   - AFIP, Loefgreen, 1235, Sao Paulo, Sao Paulo 04040-031, Brasil
XX
DR   MD5; 26d02c137161212e084971084adaacce.
DR   IMGT/HLA; DRB1*12:38; HLA08908.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood leukocytes"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:L0HRH2"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L0HRH2"
FT                   /protein_id="AGB07423.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEEYVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer