Dbfetch

ID   K02883; SV 1; linear; genomic DNA; STD; HUM; 4000 BP.
XX
AC   K02883;
XX
DT   02-JUL-1986 (Rel. 09, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class I HLA-A2 gene, complete cds.
XX
KW   antigen; cell surface antigen; cell surface glycoprotein; class I gene;
KW   glycoprotein; histocompatibility antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4000
RX   PUBMED; 2982951.
RA   Koller B.H., Orr H.T.;
RT   "Cloning and complete sequence of an HLA-A2 gene: analysis of two HLA-A
RT   alleles at the nucleotide level";
RL   J. Immunol. 134(4):2727-2733(1985).
XX
DR   MD5; 1df3bf4da9a927af4f146d068246cb38.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   EuropePMC; PMC3036124; 21637434.
DR   IMGT/HLA; HLA-A*02:01:01:01; HLA00005.
XX
CC   A variant TATA box, 'ttctaaa' is found at positions 473-479.  A
CC   polyadenylation signal is present at positions 3835-3840. An
CC   alternate initiation codon is located at positions 535-537, which
CC   results in a possible leader sequence of 21 amino acids instead of
CC   24 amino acids. There is an alternate splice site at position 3381
CC   with a stop codon at positions 3383-3385.  The same protein
CC   sequence is obtained from either splice site.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4000
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="pHLA-2a"
FT                   /cell_line="LCL 721"
FT                   /cell_type="lymphoblast"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     526..597
FT                   /gene="MHC HLA-A2"
FT   gene            526..3440
FT                   /gene="MHC HLA-A2"
FT   CDS             join(526..598,728..997,1239..1514,2114..2389,2489..2605,
FT                   3044..3076,3219..3266,3436..3440)
FT                   /codon_start=1
FT                   /gene="MHC HLA-A2"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="PDB:4NNX"
FT                   /db_xref="PDB:4NNY"
FT                   /db_xref="PDB:4NO0"
FT                   /db_xref="PDB:4NO2"
FT                   /db_xref="PDB:4NO3"
FT                   /db_xref="PDB:4NO5"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="PDB:4QOK"
FT                   /db_xref="PDB:4U6X"
FT                   /db_xref="PDB:4U6Y"
FT                   /db_xref="PDB:4UQ3"
FT                   /db_xref="PDB:4WJ5"
FT                   /db_xref="PDB:4WUU"
FT                   /db_xref="PDB:5C07"
FT                   /db_xref="PDB:5C08"
FT                   /db_xref="PDB:5C09"
FT                   /db_xref="PDB:5C0A"
FT                   /db_xref="PDB:5C0B"
FT                   /db_xref="PDB:5C0C"
FT                   /db_xref="PDB:5C0D"
FT                   /db_xref="PDB:5C0E"
FT                   /db_xref="PDB:5C0F"
FT                   /db_xref="PDB:5C0G"
FT                   /db_xref="PDB:5C0I"
FT                   /db_xref="PDB:5C0J"
FT                   /db_xref="PDB:5D2L"
FT                   /db_xref="PDB:5D2N"
FT                   /db_xref="PDB:5D9S"
FT                   /db_xref="PDB:5DDH"
FT                   /db_xref="PDB:5E00"
FT                   /db_xref="PDB:5E6I"
FT                   /db_xref="PDB:5E9D"
FT                   /db_xref="PDB:5ENW"
FT                   /db_xref="PDB:5EOT"
FT                   /db_xref="PDB:5EU3"
FT                   /db_xref="PDB:5EU4"
FT                   /db_xref="PDB:5EU5"
FT                   /db_xref="PDB:5EU6"
FT                   /db_xref="PDB:5EUO"
FT                   /db_xref="PDB:5F7D"
FT                   /db_xref="PDB:5F9J"
FT                   /db_xref="PDB:5FA3"
FT                   /db_xref="PDB:5FA4"
FT                   /db_xref="PDB:5FDW"
FT                   /db_xref="PDB:5HHM"
FT                   /db_xref="PDB:5HHN"
FT                   /db_xref="PDB:5HHO"
FT                   /db_xref="PDB:5HHP"
FT                   /db_xref="PDB:5HHQ"
FT                   /db_xref="PDB:5HYJ"
FT                   /db_xref="PDB:5IRO"
FT                   /db_xref="PDB:5ISZ"
FT                   /db_xref="PDB:5JHD"
FT                   /db_xref="PDB:5JZI"
FT                   /db_xref="PDB:5MEN"
FT                   /db_xref="PDB:5MEO"
FT                   /db_xref="PDB:5MEP"
FT                   /db_xref="PDB:5MEQ"
FT                   /db_xref="PDB:5MER"
FT                   /db_xref="PDB:5N1Y"
FT                   /db_xref="PDB:5N6B"
FT                   /db_xref="PDB:5NHT"
FT                   /db_xref="PDB:5NME"
FT                   /db_xref="PDB:5NMF"
FT                   /db_xref="PDB:5NMG"
FT                   /db_xref="PDB:5NMH"
FT                   /db_xref="PDB:5NMK"
FT                   /db_xref="PDB:5NQK"
FT                   /db_xref="PDB:5SWQ"
FT                   /db_xref="PDB:5TEZ"
FT                   /db_xref="PDB:5W1W"
FT                   /db_xref="PDB:5WSH"
FT                   /db_xref="PDB:5YXN"
FT                   /db_xref="PDB:5YXU"
FT                   /db_xref="PDB:6AM5"
FT                   /db_xref="PDB:6AMT"
FT                   /db_xref="PDB:6AMU"
FT                   /db_xref="PDB:6APN"
FT                   /db_xref="PDB:6D78"
FT                   /db_xref="PDB:6D7G"
FT                   /db_xref="PDB:6DKP"
FT                   /db_xref="PDB:6EQA"
FT                   /db_xref="PDB:6EQB"
FT                   /db_xref="PDB:6EWA"
FT                   /db_xref="PDB:6EWC"
FT                   /db_xref="PDB:6EWO"
FT                   /db_xref="PDB:6G3J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /protein_id="AAA98727.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <526..598
FT                   /gene="MHC HLA-A2"
FT                   /number=1
FT   mat_peptide     join(598,728..997,1239..1514,2114..2389,2489..2605,
FT                   3044..3076,3219..3266,3436..3437)
FT                   /gene="MHC HLA-A2"
FT                   /product="MHC class I antigen"
FT   intron          599..727
FT                   /gene="MHC HLA-A2"
FT                   /number=1
FT   exon            728..997
FT                   /gene="MHC HLA-A2"
FT                   /number=2
FT   intron          998..1238
FT                   /gene="MHC HLA-A2"
FT                   /number=2
FT   exon            1239..1514
FT                   /gene="MHC HLA-A2"
FT                   /number=3
FT   intron          1515..2113
FT                   /gene="MHC HLA-A2"
FT                   /number=3
FT   exon            2114..2389
FT                   /gene="MHC HLA-A2"
FT                   /number=4
FT   intron          2390..2488
FT                   /gene="MHC HLA-A2"
FT                   /number=4
FT   exon            2489..2605
FT                   /gene="MHC HLA-A2"
FT                   /number=5
FT   intron          2606..3043
FT                   /gene="MHC HLA-A2"
FT                   /number=5
FT   exon            3044..3076
FT                   /gene="MHC HLA-A2"
FT                   /number=6
FT   intron          3077..3218
FT                   /gene="MHC HLA-A2"
FT                   /number=6
FT   exon            3219..3266
FT                   /gene="MHC HLA-A2"
FT                   /number=7
FT   intron          3267..3435
FT                   /gene="MHC HLA-A2"
FT                   /number=7
FT   exon            3436..>3440
FT                   /gene="MHC HLA-A2"
FT                   /number=8
XX
SQ   Sequence 4000 BP; 800 A; 1105 C; 1203 G; 892 T; 0 other;
     aagcttactc tctggcacca aactccatgg gatgattttt ccttcctaga agagtccagg        60
     tggacaggta aggagtggga gtcagggagt ccagttccag ggacagagat tacgggataa       120
     aaagtgaaag gagagggacg gggcccatgc cgagggtttc tcccttgttt ctcagacagc       180
     tcttgggcca agactcaggg agacattgag acagagcgct tggcacagaa gcagaggggt       240
     cagggcgaag tccagggccc caggcgttgg ctctcagggt ctcaggcccc gaaggcggtg       300
     tatggattgg ggagtcccag ccttggggat tccccaactc cgcagtttct tttctccctc       360
     tcccaaccta tgtagggtcc ttcttcctgg atactcacga cgcggaccca gttctcactc       420
     ccattgggtg tcgggtttcc agagaagcca atcagtgtcg tcgcggtcgc ggttctaaag       480
     tccgcacgca cccaccggga ctcagattct ccccagacgc cgaggatggc cgtcatggcg       540
     ccccgaaccc tcgtcctgct actctcgggg gctctggccc tgacccagac ctgggcgggt       600
     gagtgcgggg tcgggaggga aacggcctct gtggggagaa gcaacgggcc gcctggcggg       660
     ggcgcaggac ccgggaagcc gcgccgggag gagggtcggg cgggtctcag ccactcctcg       720
     tccccaggct ctcactccat gaggtatttc ttcacatccg tgtcccggcc cggccgcggg       780
     gagccccgct tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg gttcgacagc       840
     gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga gggtccggag       900
     tattgggacg gggagacacg gaaagtgaag gcccactcac agactcaccg agtggacctg       960
     gggaccctgc gcggctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg      1020
     caggtcacga cctctcatcc cccacggacg ggccaggtcg cccacagtct ccgggtccga      1080
     gatccgcccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc caggcgcctt      1140
     tacccggttt cattttcagt ttaggccaaa aatcccccca ggttggtcgg ggcggggcgg      1200
     ggctcggggg accgggctga ccgcggggtc cgggccaggt tctcacaccg tccagaggat      1260
     gtatggctgc gacgtggggt cggactggcg cttcctccgc gggtaccacc agtacgccta      1320
     cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg cggcggacat      1380
     ggcagctcag accaccaagc acaagtggga ggcggcccat gtggcggagc agttgagagc      1440
     ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac      1500
     gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg tagatctccc      1560
     gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata tcgccctccc      1620
     tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag agagtgactc      1680
     tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgaag gaatgacggg      1740
     aagacgatcc ctcgaatact gatgagtggt tccctttgac acacacaggc agcagccttg      1800
     ggcccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt      1860
     ctgagtccag cacttctgag tccttcagcc tccactcagg tcaggaccag aagtcgctgt      1920
     tccctcttca gggactagaa tttccacgga ataggagatt atcccaggtg cctgtgtcca      1980
     ggctggtgtc tgggttctgt gctcccttcc ccatcccagg tgtcctgtcc attctcaaga      2040
     tagccacatg tgtgctggag gagtgtccca tgacagatcg aaaatgcctg aatgatctga      2100
     ctcttcctga cagacgcccc caaaacgcat atgactcacc acgctgtctc tgaccatgaa      2160
     gccaccctga ggtgctgggc cctgagcttc taccctgcgg agatcacact gacctggcag      2220
     cgggatgggg aggaccagac ccaggacacg gagctcgtgg agaccaggcc tgcaggggat      2280
     ggaaccttcc agaagtgggc ggctgtggtg gtgccttctg gacaggagca gagatacacc      2340
     tgccatgtgc agcatgaggg tttgcccaag cccctcaccc tgagatgggg taaggaggga      2400
     gacgggggtg tcatgtcttt tagggaaagc aggagcctct ctgaccttta gcagggtcag      2460
     ggcccctcac cttcccctct tttcccagag ccgtcttccc agcccaccat ccccatcgtg      2520
     ggcatcattg ctggcctggt tctctttgga gctgtgatca ctggagctgt ggtcgctgct      2580
     gtgatgtgga ggaggaagag ctcaggtggg gaaggggtga agggtgggtc tgagatttct      2640
     tgtctcactg agggttccaa gacccaggta gaagtgtgcc ctgcctcgtt actgggaagc      2700
     accacccaca attatgggcc tacccagcct gggccctgtg tgccagcact tactcttttg      2760
     taaagcacct gttaaaatga aggacagatt tatcaccttg attacagcgg tgatgggacc      2820
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gaccttcagg agggcggttg      2880
     gtccaggacc cacacctgct ttcttcatgt ttcctgatcc cgccctgggt ctgcagtcac      2940
     acatttctgg aaacttctct gaggtccaag acttggaggt tcctctagga ccttaaggcc      3000
     ctgactcttt tctggtatct cacaggacat tttcttccca cagatagaaa aggagggagc      3060
     tactctcagg ctgcaagtaa gtatgaagga ggctgatgcc tgaggtcctt gggatattgt      3120
     gtttgggagc ccatggggga gctcacccac cccacaattc ctcctctagc cacatcttct      3180
     gtgggatctg accaggttct gtttttgttc taccccaggc agtgacagtg cccagggctc      3240
     tgatgtgtct ctcacagctt gtaaaggtga gagcctggag ggcctgatgt gtgttgggtg      3300
     ttgggcggaa cagtggacac agctgtgcta tggggtttct ttccattgga tgtattgagc      3360
     atgcgatggg ctgtttaaag tgtgacccct cactgtgaca gatacgaatt tgttcatgaa      3420
     tatttttttc tatagtgtga gacagctgcc ttgtgtggga ctgagaggca agagttgttc      3480
     ctgcccttcc ctttgtgact tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg      3540
     tgtctgtgtt cgtgtaggca taatgtgagg aggtggggag accaccccac ccccatgtcc      3600
     accatgaccc tcttcccacg ctgacctgtg ctccctcccc aatcatcttt cctgttccag      3660
     agaggtgggg ctgaggtgtc tccatctctg tctcaacttc atggtgcact gagctgtaac      3720
     ttcttccttc cctattaaaa ttagaacctg agtataaatt tactttctca aattcttgcc      3780
     atgagaggtt gatgagttaa ttaaaggaga agattcctaa aatttgagag acaaaataaa      3840
     tggaacacat gagaaccttc cagagtccac gtgttgctta tgctgatttg ttgcagggga      3900
     ggagagtaga tggggctgtg cccagtttct gttccggcca ctatgggctt tatgtggtca      3960
     ctgcttggct gggtcatctt tgctgctcca ttgtccttgg                            4000
//