Dbfetch
ID K02883; SV 1; linear; genomic DNA; STD; HUM; 4000 BP. XX AC K02883; XX DT 02-JUL-1986 (Rel. 09, Created) DT 17-JUN-2008 (Rel. 96, Last updated, Version 11) XX DE Human MHC class I HLA-A2 gene, complete cds. XX KW antigen; cell surface antigen; cell surface glycoprotein; class I gene; KW glycoprotein; histocompatibility antigen; major histocompatibility complex. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-4000 RX PUBMED; 2982951. RA Koller B.H., Orr H.T.; RT "Cloning and complete sequence of an HLA-A2 gene: analysis of two HLA-A RT alleles at the nucleotide level"; RL J. Immunol. 134(4):2727-2733(1985). XX DR MD5; 1df3bf4da9a927af4f146d068246cb38. DR Ensembl-Gn; ENSG00000235657; homo_sapiens. DR Ensembl-Tr; ENST00000457879; homo_sapiens. DR Ensembl-Tr; ENST00000547271; homo_sapiens. DR EuropePMC; PMC3036124; 21637434. DR IMGT/HLA; HLA-A*02:01:01:01; HLA00005. XX CC A variant TATA box, 'ttctaaa' is found at positions 473-479. A CC polyadenylation signal is present at positions 3835-3840. An CC alternate initiation codon is located at positions 535-537, which CC results in a possible leader sequence of 21 amino acids instead of CC 24 amino acids. There is an alternate splice site at position 3381 CC with a stop codon at positions 3383-3385. The same protein CC sequence is obtained from either splice site. XX FH Key Location/Qualifiers FH FT source 1..4000 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /clone="pHLA-2a" FT /cell_line="LCL 721" FT /cell_type="lymphoblast" FT /db_xref="taxon:9606" FT sig_peptide 526..597 FT /gene="MHC HLA-A2" FT gene 526..3440 FT /gene="MHC HLA-A2" FT CDS join(526..598,728..997,1239..1514,2114..2389,2489..2605, FT 3044..3076,3219..3266,3436..3440) FT /codon_start=1 FT /gene="MHC HLA-A2" FT /product="MHC class I antigen" FT /db_xref="GOA:P01892" FT /db_xref="HGNC:HGNC:4931" FT /db_xref="InterPro:IPR001039" FT /db_xref="InterPro:IPR003006" FT /db_xref="InterPro:IPR003597" FT /db_xref="InterPro:IPR007110" FT /db_xref="InterPro:IPR010579" FT /db_xref="InterPro:IPR011161" FT /db_xref="InterPro:IPR011162" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR036179" FT /db_xref="InterPro:IPR037055" FT /db_xref="PDB:1AKJ" FT /db_xref="PDB:1AO7" FT /db_xref="PDB:1AQD" FT /db_xref="PDB:1B0G" FT /db_xref="PDB:1B0R" FT /db_xref="PDB:1BD2" FT /db_xref="PDB:1DUY" FT /db_xref="PDB:1DUZ" FT /db_xref="PDB:1EEY" FT /db_xref="PDB:1EEZ" FT /db_xref="PDB:1HHG" FT /db_xref="PDB:1HHH" FT /db_xref="PDB:1HHI" FT /db_xref="PDB:1HHJ" FT /db_xref="PDB:1HHK" FT /db_xref="PDB:1HLA" FT /db_xref="PDB:1I1F" FT /db_xref="PDB:1I1Y" FT /db_xref="PDB:1I4F" FT /db_xref="PDB:1I7R" FT /db_xref="PDB:1I7T" FT /db_xref="PDB:1I7U" FT /db_xref="PDB:1IM3" FT /db_xref="PDB:1JF1" FT /db_xref="PDB:1JHT" FT /db_xref="PDB:1LP9" FT /db_xref="PDB:1OGA" FT /db_xref="PDB:1P7Q" FT /db_xref="PDB:1QEW" FT /db_xref="PDB:1QR1" FT /db_xref="PDB:1QRN" FT /db_xref="PDB:1QSE" FT /db_xref="PDB:1QSF" FT /db_xref="PDB:1S8D" FT /db_xref="PDB:1S9W" FT /db_xref="PDB:1S9X" FT /db_xref="PDB:1S9Y" FT /db_xref="PDB:1T1W" FT /db_xref="PDB:1T1X" FT /db_xref="PDB:1T1Y" FT /db_xref="PDB:1T1Z" FT /db_xref="PDB:1T20" FT /db_xref="PDB:1T21" FT /db_xref="PDB:1T22" FT /db_xref="PDB:1TVB" FT /db_xref="PDB:1TVH" FT /db_xref="PDB:1UR7" FT /db_xref="PDB:2AV1" FT /db_xref="PDB:2AV7" FT /db_xref="PDB:2BNQ" FT /db_xref="PDB:2BNR" FT /db_xref="PDB:2C7U" FT /db_xref="PDB:2CLR" FT /db_xref="PDB:2F53" FT /db_xref="PDB:2F54" FT /db_xref="PDB:2GIT" FT /db_xref="PDB:2GJ6" FT /db_xref="PDB:2GT9" FT /db_xref="PDB:2GTW" FT /db_xref="PDB:2GTZ" FT /db_xref="PDB:2GUO" FT /db_xref="PDB:2J8U" FT /db_xref="PDB:2JCC" FT /db_xref="PDB:2P5E" FT /db_xref="PDB:2P5W" FT /db_xref="PDB:2PYE" FT /db_xref="PDB:2UWE" FT /db_xref="PDB:2V2W" FT /db_xref="PDB:2V2X" FT /db_xref="PDB:2VLJ" FT /db_xref="PDB:2VLK" FT /db_xref="PDB:2VLL" FT /db_xref="PDB:2VLR" FT /db_xref="PDB:2X4N" FT /db_xref="PDB:2X4O" FT /db_xref="PDB:2X4P" FT /db_xref="PDB:2X4Q" FT /db_xref="PDB:2X4R" FT /db_xref="PDB:2X4S" FT /db_xref="PDB:2X4T" FT /db_xref="PDB:2X4U" FT /db_xref="PDB:2X70" FT /db_xref="PDB:3BGM" FT /db_xref="PDB:3BH8" FT /db_xref="PDB:3BH9" FT /db_xref="PDB:3BHB" FT /db_xref="PDB:3D25" FT /db_xref="PDB:3D39" FT /db_xref="PDB:3D3V" FT /db_xref="PDB:3FQN" FT /db_xref="PDB:3FQR" FT /db_xref="PDB:3FQT" FT /db_xref="PDB:3FQU" FT /db_xref="PDB:3FQW" FT /db_xref="PDB:3FQX" FT /db_xref="PDB:3FT2" FT /db_xref="PDB:3FT3" FT /db_xref="PDB:3FT4" FT /db_xref="PDB:3GIV" FT /db_xref="PDB:3GJF" FT /db_xref="PDB:3GSN" FT /db_xref="PDB:3GSO" FT /db_xref="PDB:3GSQ" FT /db_xref="PDB:3GSR" FT /db_xref="PDB:3GSU" FT /db_xref="PDB:3GSV" FT /db_xref="PDB:3GSW" FT /db_xref="PDB:3GSX" FT /db_xref="PDB:3H7B" FT /db_xref="PDB:3H9H" FT /db_xref="PDB:3H9S" FT /db_xref="PDB:3HAE" FT /db_xref="PDB:3HLA" FT /db_xref="PDB:3HPJ" FT /db_xref="PDB:3I6G" FT /db_xref="PDB:3I6K" FT /db_xref="PDB:3IXA" FT /db_xref="PDB:3KLA" FT /db_xref="PDB:3MGO" FT /db_xref="PDB:3MGT" FT /db_xref="PDB:3MR9" FT /db_xref="PDB:3MRB" FT /db_xref="PDB:3MRC" FT /db_xref="PDB:3MRD" FT /db_xref="PDB:3MRE" FT /db_xref="PDB:3MRF" FT /db_xref="PDB:3MRG" FT /db_xref="PDB:3MRH" FT /db_xref="PDB:3MRI" FT /db_xref="PDB:3MRJ" FT /db_xref="PDB:3MRK" FT /db_xref="PDB:3MRL" FT /db_xref="PDB:3MRM" FT /db_xref="PDB:3MRN" FT /db_xref="PDB:3MRO" FT /db_xref="PDB:3MRP" FT /db_xref="PDB:3MRQ" FT /db_xref="PDB:3MRR" FT /db_xref="PDB:3MYJ" FT /db_xref="PDB:3O3A" FT /db_xref="PDB:3O3B" FT /db_xref="PDB:3O3D" FT /db_xref="PDB:3O3E" FT /db_xref="PDB:3O4L" FT /db_xref="PDB:3PWJ" FT /db_xref="PDB:3PWL" FT /db_xref="PDB:3PWN" FT /db_xref="PDB:3PWP" FT /db_xref="PDB:3QDG" FT /db_xref="PDB:3QDJ" FT /db_xref="PDB:3QDM" FT /db_xref="PDB:3QEQ" FT /db_xref="PDB:3QFD" FT /db_xref="PDB:3QFJ" FT /db_xref="PDB:3REW" FT /db_xref="PDB:3TO2" FT /db_xref="PDB:3UTQ" FT /db_xref="PDB:3UTS" FT /db_xref="PDB:3UTT" FT /db_xref="PDB:3V5D" FT /db_xref="PDB:3V5H" FT /db_xref="PDB:3V5K" FT /db_xref="PDB:4E5X" FT /db_xref="PDB:4EMZ" FT /db_xref="PDB:4EN2" FT /db_xref="PDB:4EUP" FT /db_xref="PDB:4FTV" FT /db_xref="PDB:4GKN" FT /db_xref="PDB:4GKS" FT /db_xref="PDB:4I4W" FT /db_xref="PDB:4JFD" FT /db_xref="PDB:4JFE" FT /db_xref="PDB:4JFF" FT /db_xref="PDB:4JFO" FT /db_xref="PDB:4JFP" FT /db_xref="PDB:4JFQ" FT /db_xref="PDB:4K7F" FT /db_xref="PDB:4L29" FT /db_xref="PDB:4L3C" FT /db_xref="PDB:4L3E" FT /db_xref="PDB:4MNQ" FT /db_xref="PDB:4NNX" FT /db_xref="PDB:4NNY" FT /db_xref="PDB:4NO0" FT /db_xref="PDB:4NO2" FT /db_xref="PDB:4NO3" FT /db_xref="PDB:4NO5" FT /db_xref="PDB:4OV5" FT /db_xref="PDB:4QOK" FT /db_xref="PDB:4U6X" FT /db_xref="PDB:4U6Y" FT /db_xref="PDB:4UQ3" FT /db_xref="PDB:4WJ5" FT /db_xref="PDB:4WUU" FT /db_xref="PDB:5C07" FT /db_xref="PDB:5C08" FT /db_xref="PDB:5C09" FT /db_xref="PDB:5C0A" FT /db_xref="PDB:5C0B" FT /db_xref="PDB:5C0C" FT /db_xref="PDB:5C0D" FT /db_xref="PDB:5C0E" FT /db_xref="PDB:5C0F" FT /db_xref="PDB:5C0G" FT /db_xref="PDB:5C0I" FT /db_xref="PDB:5C0J" FT /db_xref="PDB:5D2L" FT /db_xref="PDB:5D2N" FT /db_xref="PDB:5D9S" FT /db_xref="PDB:5DDH" FT /db_xref="PDB:5E00" FT /db_xref="PDB:5E6I" FT /db_xref="PDB:5E9D" FT /db_xref="PDB:5ENW" FT /db_xref="PDB:5EOT" FT /db_xref="PDB:5EU3" FT /db_xref="PDB:5EU4" FT /db_xref="PDB:5EU5" FT /db_xref="PDB:5EU6" FT /db_xref="PDB:5EUO" FT /db_xref="PDB:5F7D" FT /db_xref="PDB:5F9J" FT /db_xref="PDB:5FA3" FT /db_xref="PDB:5FA4" FT /db_xref="PDB:5FDW" FT /db_xref="PDB:5HHM" FT /db_xref="PDB:5HHN" FT /db_xref="PDB:5HHO" FT /db_xref="PDB:5HHP" FT /db_xref="PDB:5HHQ" FT /db_xref="PDB:5HYJ" FT /db_xref="PDB:5IRO" FT /db_xref="PDB:5ISZ" FT /db_xref="PDB:5JHD" FT /db_xref="PDB:5JZI" FT /db_xref="PDB:5MEN" FT /db_xref="PDB:5MEO" FT /db_xref="PDB:5MEP" FT /db_xref="PDB:5MEQ" FT /db_xref="PDB:5MER" FT /db_xref="PDB:5N1Y" FT /db_xref="PDB:5N6B" FT /db_xref="PDB:5NHT" FT /db_xref="PDB:5NME" FT /db_xref="PDB:5NMF" FT /db_xref="PDB:5NMG" FT /db_xref="PDB:5NMH" FT /db_xref="PDB:5NMK" FT /db_xref="PDB:5NQK" FT /db_xref="PDB:5SWQ" FT /db_xref="PDB:5TEZ" FT /db_xref="PDB:5W1W" FT /db_xref="PDB:5WSH" FT /db_xref="PDB:5YXN" FT /db_xref="PDB:5YXU" FT /db_xref="PDB:6AM5" FT /db_xref="PDB:6AMT" FT /db_xref="PDB:6AMU" FT /db_xref="PDB:6APN" FT /db_xref="PDB:6D78" FT /db_xref="PDB:6D7G" FT /db_xref="PDB:6DKP" FT /db_xref="PDB:6EQA" FT /db_xref="PDB:6EQB" FT /db_xref="PDB:6EWA" FT /db_xref="PDB:6EWC" FT /db_xref="PDB:6EWO" FT /db_xref="PDB:6G3J" FT /db_xref="UniProtKB/Swiss-Prot:P01892" FT /protein_id="AAA98727.1" FT /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR FT FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT FT LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA FT AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE FT ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY FT TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK FT GGSYSQAASSDSAQGSDVSLTACKV" FT exon <526..598 FT /gene="MHC HLA-A2" FT /number=1 FT mat_peptide join(598,728..997,1239..1514,2114..2389,2489..2605, FT 3044..3076,3219..3266,3436..3437) FT /gene="MHC HLA-A2" FT /product="MHC class I antigen" FT intron 599..727 FT /gene="MHC HLA-A2" FT /number=1 FT exon 728..997 FT /gene="MHC HLA-A2" FT /number=2 FT intron 998..1238 FT /gene="MHC HLA-A2" FT /number=2 FT exon 1239..1514 FT /gene="MHC HLA-A2" FT /number=3 FT intron 1515..2113 FT /gene="MHC HLA-A2" FT /number=3 FT exon 2114..2389 FT /gene="MHC HLA-A2" FT /number=4 FT intron 2390..2488 FT /gene="MHC HLA-A2" FT /number=4 FT exon 2489..2605 FT /gene="MHC HLA-A2" FT /number=5 FT intron 2606..3043 FT /gene="MHC HLA-A2" FT /number=5 FT exon 3044..3076 FT /gene="MHC HLA-A2" FT /number=6 FT intron 3077..3218 FT /gene="MHC HLA-A2" FT /number=6 FT exon 3219..3266 FT /gene="MHC HLA-A2" FT /number=7 FT intron 3267..3435 FT /gene="MHC HLA-A2" FT /number=7 FT exon 3436..>3440 FT /gene="MHC HLA-A2" FT /number=8 XX SQ Sequence 4000 BP; 800 A; 1105 C; 1203 G; 892 T; 0 other; aagcttactc tctggcacca aactccatgg gatgattttt ccttcctaga agagtccagg 60 tggacaggta aggagtggga gtcagggagt ccagttccag ggacagagat tacgggataa 120 aaagtgaaag gagagggacg gggcccatgc cgagggtttc tcccttgttt ctcagacagc 180 tcttgggcca agactcaggg agacattgag acagagcgct tggcacagaa gcagaggggt 240 cagggcgaag tccagggccc caggcgttgg ctctcagggt ctcaggcccc gaaggcggtg 300 tatggattgg ggagtcccag ccttggggat tccccaactc cgcagtttct tttctccctc 360 tcccaaccta tgtagggtcc ttcttcctgg atactcacga cgcggaccca gttctcactc 420 ccattgggtg tcgggtttcc agagaagcca atcagtgtcg tcgcggtcgc ggttctaaag 480 tccgcacgca cccaccggga ctcagattct ccccagacgc cgaggatggc cgtcatggcg 540 ccccgaaccc tcgtcctgct actctcgggg gctctggccc tgacccagac ctgggcgggt 600 gagtgcgggg tcgggaggga aacggcctct gtggggagaa gcaacgggcc gcctggcggg 660 ggcgcaggac ccgggaagcc gcgccgggag gagggtcggg cgggtctcag ccactcctcg 720 tccccaggct ctcactccat gaggtatttc ttcacatccg tgtcccggcc cggccgcggg 780 gagccccgct tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg gttcgacagc 840 gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga gggtccggag 900 tattgggacg gggagacacg gaaagtgaag gcccactcac agactcaccg agtggacctg 960 gggaccctgc gcggctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg 1020 caggtcacga cctctcatcc cccacggacg ggccaggtcg cccacagtct ccgggtccga 1080 gatccgcccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc caggcgcctt 1140 tacccggttt cattttcagt ttaggccaaa aatcccccca ggttggtcgg ggcggggcgg 1200 ggctcggggg accgggctga ccgcggggtc cgggccaggt tctcacaccg tccagaggat 1260 gtatggctgc gacgtggggt cggactggcg cttcctccgc gggtaccacc agtacgccta 1320 cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg cggcggacat 1380 ggcagctcag accaccaagc acaagtggga ggcggcccat gtggcggagc agttgagagc 1440 ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac 1500 gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg tagatctccc 1560 gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata tcgccctccc 1620 tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag agagtgactc 1680 tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgaag gaatgacggg 1740 aagacgatcc ctcgaatact gatgagtggt tccctttgac acacacaggc agcagccttg 1800 ggcccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt 1860 ctgagtccag cacttctgag tccttcagcc tccactcagg tcaggaccag aagtcgctgt 1920 tccctcttca gggactagaa tttccacgga ataggagatt atcccaggtg cctgtgtcca 1980 ggctggtgtc tgggttctgt gctcccttcc ccatcccagg tgtcctgtcc attctcaaga 2040 tagccacatg tgtgctggag gagtgtccca tgacagatcg aaaatgcctg aatgatctga 2100 ctcttcctga cagacgcccc caaaacgcat atgactcacc acgctgtctc tgaccatgaa 2160 gccaccctga ggtgctgggc cctgagcttc taccctgcgg agatcacact gacctggcag 2220 cgggatgggg aggaccagac ccaggacacg gagctcgtgg agaccaggcc tgcaggggat 2280 ggaaccttcc agaagtgggc ggctgtggtg gtgccttctg gacaggagca gagatacacc 2340 tgccatgtgc agcatgaggg tttgcccaag cccctcaccc tgagatgggg taaggaggga 2400 gacgggggtg tcatgtcttt tagggaaagc aggagcctct ctgaccttta gcagggtcag 2460 ggcccctcac cttcccctct tttcccagag ccgtcttccc agcccaccat ccccatcgtg 2520 ggcatcattg ctggcctggt tctctttgga gctgtgatca ctggagctgt ggtcgctgct 2580 gtgatgtgga ggaggaagag ctcaggtggg gaaggggtga agggtgggtc tgagatttct 2640 tgtctcactg agggttccaa gacccaggta gaagtgtgcc ctgcctcgtt actgggaagc 2700 accacccaca attatgggcc tacccagcct gggccctgtg tgccagcact tactcttttg 2760 taaagcacct gttaaaatga aggacagatt tatcaccttg attacagcgg tgatgggacc 2820 tgatcccagc agtcacaagt cacaggggaa ggtccctgag gaccttcagg agggcggttg 2880 gtccaggacc cacacctgct ttcttcatgt ttcctgatcc cgccctgggt ctgcagtcac 2940 acatttctgg aaacttctct gaggtccaag acttggaggt tcctctagga ccttaaggcc 3000 ctgactcttt tctggtatct cacaggacat tttcttccca cagatagaaa aggagggagc 3060 tactctcagg ctgcaagtaa gtatgaagga ggctgatgcc tgaggtcctt gggatattgt 3120 gtttgggagc ccatggggga gctcacccac cccacaattc ctcctctagc cacatcttct 3180 gtgggatctg accaggttct gtttttgttc taccccaggc agtgacagtg cccagggctc 3240 tgatgtgtct ctcacagctt gtaaaggtga gagcctggag ggcctgatgt gtgttgggtg 3300 ttgggcggaa cagtggacac agctgtgcta tggggtttct ttccattgga tgtattgagc 3360 atgcgatggg ctgtttaaag tgtgacccct cactgtgaca gatacgaatt tgttcatgaa 3420 tatttttttc tatagtgtga gacagctgcc ttgtgtggga ctgagaggca agagttgttc 3480 ctgcccttcc ctttgtgact tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg 3540 tgtctgtgtt cgtgtaggca taatgtgagg aggtggggag accaccccac ccccatgtcc 3600 accatgaccc tcttcccacg ctgacctgtg ctccctcccc aatcatcttt cctgttccag 3660 agaggtgggg ctgaggtgtc tccatctctg tctcaacttc atggtgcact gagctgtaac 3720 ttcttccttc cctattaaaa ttagaacctg agtataaatt tactttctca aattcttgcc 3780 atgagaggtt gatgagttaa ttaaaggaga agattcctaa aatttgagag acaaaataaa 3840 tggaacacat gagaaccttc cagagtccac gtgttgctta tgctgatttg ttgcagggga 3900 ggagagtaga tggggctgtg cccagtttct gttccggcca ctatgggctt tatgtggtca 3960 ctgcttggct gggtcatctt tgctgctcca ttgtccttgg 4000 //