Dbfetch

ID   AH005273; SV 2; linear; genomic DNA; STD; HUM; 12223 BP.
XX
AC   AH005273; J00221-J00222; J00230; K01316-K01319; V00554;
XX
DT   03-AUG-2016 (Rel. 129, Created)
DT   03-AUG-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens immunoglobulin gamma-2 heavy chain (IgH), immunoglobulin
DE   gamma-4 heavy chain (IgH), immunoglobulin epsilon chain constant region
DE   (IgH), and immunoglobulin alpha-2 heavy chain (IgH) genes, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   2110-4137
RX   PUBMED; 6299662.
RA   Ellison J., Buxbaum J., Hood L.;
RT   "Nucleotide sequence of a human immunoglobulin C gamma 4 gene";
RL   DNA 1(1):11-18(1981).
XX
RN   [2]
RP   6219-9607
RX   PUBMED; 6327276.
RA   Ueda S., Nakai S., Nishida Y., Hisajima H., Honjo T.;
RT   "Long terminal repeat-like elements flank a human immunoglobulin epsilon
RT   pseudogene that lacks introns";
RL   EMBO J. 1(12):1539-1544(1982).
XX
RN   [3]
RP   896-1256,1749-1937,3003-3215
RX   PUBMED; 6329676.
RA   Krawinkel U., Rabbitts T.H.;
RT   "Comparison of the hinge-coding segments in human immunoglobulin gamma
RT   heavy chain genes and the linkage of the gamma 2 and gamma 4 subclass
RT   genes";
RL   EMBO J. 1(4):403-407(1982).
XX
RN   [4]
RP   1-12223
RX   DOI; 10.1073/pnas.79.6.1984.
RX   PUBMED; 6804948.
RA   Ellison J., Hood L.;
RT   "Linkage and sequence homology of two human immunoglobulin gamma heavy
RT   chain constant region genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 79(6):1984-1988(1982).
XX
RN   [5]
RP   7330-9326
RX   DOI; 10.1016/0092-8674(82)90185-4.
RX   PUBMED; 6288268.
RA   Max E.E., Battey J., Ney R., Kirsch I.R., Leder P.;
RT   "Duplication and deletion in the human immunoglobulin epsilon genes";
RL   Cell 29(2):691-699(1982).
XX
RN   [6]
RP   475-1071,1179-1330,1461-1524,2584-3178,3289-3440,3541-3764
RX   DOI; 10.1016/0092-8674(82)90183-0.
RX   PUBMED; 6811139.
RA   Takahashi N., Ueda S., Obata M., Nikaido T., Nakai S., Honjo T.;
RT   "Structure of human immunoglobulin gamma genes: implications for evolution
RT   of a gene family";
RL   Cell 29(2):671-679(1982).
XX
RN   [7]
RP   10444-10723
RX   DOI; 10.1038/300709a0.
RX   PUBMED; 6817141.
RA   Flanagan J.G., Rabbitts T.H.;
RT   "Arrangement of human immunoglobulin heavy chain constant region genes
RT   implies evolutionary duplication of a segment containing gamma, epsilon and
RT   alpha genes";
RL   Nature 300(5894):709-713(1982).
XX
RN   [8]
RP   4238-4998,5099-5374,5475-6118,8250-9606,9756-9936,10132-10221
RX   DOI; 10.1073/pnas.80.10.2995.
RX   PUBMED; 6407005.
RA   Hisajima H., Nishida Y., Nakai S., Takahashi N., Ueda S., Honjo T.;
RT   "Structure of the human immunoglobulin C epsilon 2 gene, a truncated
RT   pseudogene: implications for its evolutionary origin";
RL   Proc. Natl. Acad. Sci. U.S.A. 80(10):2995-2999(1983).
XX
RN   [9]
RP   9708-12223
RX   DOI; 10.1016/0092-8674(84)90348-9.
RX   PUBMED; 6421489.
RA   Flanagan J.G., Lefranc M.P., Rabbitts T.H.;
RT   "Mechanisms of divergence and convergence of the human immunoglobulin alpha
RT   1 and alpha 2 constant region gene sequences";
RL   Cell 36(3):681-688(1984).
XX
DR   MD5; 6a436067d63d509a8a4d392b80f7fae4.
XX
CC   On or before Aug 1, 2016 this sequence version replaced gi:184750,
CC   gi:184751, gi:184752, gi:184753, gi:184754, gi:184755, gi:184756,
CC   gi:184757.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12223
FT                   /organism="Homo sapiens"
FT                   /map="14q32.33"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   gene            <1..2009
FT                   /gene="IgH"
FT                   /note="IGHG2"
FT   intron          <1..215
FT                   /gene="IgH"
FT   CDS             join(<216..509,902..937,1056..1382,1480..1802)
FT                   /codon_start=3
FT                   /gene="IgH"
FT                   /product="immunoglobulin gamma-2 heavy chain"
FT                   /protein_id="AAB59393.1"
FT                   /translation="STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL
FT                   TSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVE
FT                   CPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVH
FT                   NAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPR
FT                   EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGS
FT                   FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
FT   exon            216..509
FT                   /gene="IgH"
FT                   /note="G00-119-338"
FT   C_region        216..508
FT                   /gene="IgH"
FT                   /note="immunoglobulin heavy chain constant region CH1"
FT   intron          510..901
FT                   /gene="IgH"
FT   misc_difference 537
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 550..551
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 570
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 777..778
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 791
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 864
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   C_region        901..936
FT                   /gene="IgH"
FT                   /note="immunoglobulin heavy chain hinge"
FT   exon            902..937
FT                   /gene="IgH"
FT                   /note="G00-119-338"
FT   intron          938..1055
FT                   /gene="IgH"
FT   C_region        1055..1381
FT                   /gene="IgH"
FT                   /note="immunoglobulin heavy chain constant region CH2"
FT   exon            1056..1382
FT                   /gene="IgH"
FT                   /note="G00-119-338"
FT   intron          1383..1479
FT                   /gene="IgH"
FT   C_region        1479..1799
FT                   /gene="IgH"
FT                   /note="immunoglobulin heavy chain constant region CH3"
FT   exon            1480..1802
FT                   /gene="IgH"
FT                   /note="G00-119-338"
FT   misc_difference 1493
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[6]
FT   misc_difference 1802..1806
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 1814..1815
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 1825
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 1844..1853
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 1890
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   regulatory      1903..1908
FT                   /gene="IgH"
FT                   /regulatory_class="polyA_signal_sequence"
FT   misc_difference 1909..1918
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   misc_difference 1929..1932
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[3]
FT   gap             2010..2109
FT                   /estimated_length=unknown
FT   gene            <2110..4137
FT                   /gene="IgH"
FT                   /note="IGHG4"
FT   intron          <2110..2324
FT                   /gene="IgH"
FT                   /note="gamma-4 intron J-C"
FT   CDS             join(<2325..2618,3009..3044,3163..3492,3590..3912)
FT                   /codon_start=3
FT                   /gene="IgH"
FT                   /product="immunoglobulin gamma-4 heavy chain"
FT                   /protein_id="AAB59394.1"
FT                   /translation="STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL
FT                   TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPP
FT                   CPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEV
FT                   HNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQP
FT                   REPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
FT                   SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK"
FT   exon            2325..2618
FT                   /gene="IgH"
FT                   /note="G00-119-340"
FT   intron          2619..3008
FT                   /gene="IgH"
FT   exon            3009..3044
FT                   /gene="IgH"
FT   intron          3045..3162
FT                   /gene="IgH"
FT   exon            3163..3492
FT                   /gene="IgH"
FT   intron          3493..3589
FT                   /gene="IgH"
FT   exon            3590..3912
FT                   /gene="IgH"
FT   gap             4138..4237
FT                   /estimated_length=unknown
FT   gene            4238..6118
FT                   /gene="IgH"
FT                   /note="IGHEP1"
FT   intron          <4238..>4998
FT                   /gene="IgH"
FT                   /note="epsilon-1 intron J-C; G00-119-336"
FT   gap             4999..5098
FT                   /estimated_length=unknown
FT   intron          <5099..>5374
FT                   /gene="IgH"
FT                   /note="epsilon-1 intron J-C; G00-119-336"
FT   gap             5375..5474
FT                   /estimated_length=unknown
FT   intron          <5475..>6118
FT                   /gene="IgH"
FT                   /note="epsilon-1 intron J-C; G00-119-336"
FT   gap             6119..6218
FT                   /estimated_length=unknown
FT   gene            <6219..9090
FT                   /gene="IgH"
FT                   /note="IGHE"
FT   intron          <6219..7427
FT                   /gene="IgH"
FT   misc_difference 7364
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 7373
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   CDS             join(<7428..7736,7944..8264,8351..8674,8758..9089)
FT                   /codon_start=3
FT                   /gene="IgH"
FT                   /product="immunoglobulin epsilon chain constant region"
FT                   /protein_id="AAB59395.1"
FT                   /translation="STQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTCDTG
FT                   SLNGTTMTLPATTLTLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVC
FT                   SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTAS
FT                   TTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSR
FT                   PSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTS
FT                   TLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKR
FT                   TLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQK
FT                   DEFICRAVHEAASPSQTVQRAVSVNPGK"
FT   exon            7428..7736
FT                   /gene="IgH"
FT                   /note="G00-119-335"
FT   misc_difference 7555
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   intron          7737..7943
FT                   /gene="IgH"
FT   misc_difference 7846..7847
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 7936
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   exon            7944..8264
FT                   /gene="IgH"
FT   intron          8265..8350
FT                   /gene="IgH"
FT   exon            8351..8674
FT                   /gene="IgH"
FT   misc_difference 8569
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[8]
FT   misc_difference 8634
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[8]
FT   intron          8675..8757
FT                   /gene="IgH"
FT   exon            8758..9090
FT                   /gene="IgH"
FT   misc_difference 8878
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 8900
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 8972
FT                   /gene="IgH"
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 9220..9224
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[8]
FT   misc_difference 9225..9226
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 9284..9289
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   misc_difference 9325
FT                   /replace=""
FT                   /note="conflict"
FT                   /citation=[5]
FT   gap             9608..9707
FT                   /estimated_length=unknown
FT   gene            <9708..11328
FT                   /gene="IgH"
FT                   /note="IGHA2"
FT   intron          <9708..9870
FT                   /gene="IgH"
FT                   /note="alpha-2 intron J-C"
FT   CDS             join(<9871..10176,10391..10711,10934..11328)
FT                   /codon_start=3
FT                   /gene="IgH"
FT                   /product="immunoglobulin alpha-2 heavy chain"
FT                   /note="contains constant region"
FT                   /protein_id="AAB59396.1"
FT                   /translation="SPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQ
FT                   NVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPP
FT                   PPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPER
FT                   DLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPP
FT                   SEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVT
FT                   SILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY"
FT   exon            9871..10176
FT                   /gene="IgH"
FT                   /note="G00-119-333"
FT   intron          10177..10390
FT                   /gene="IgH"
FT                   /note="alpha-2 intron A"
FT   exon            10391..10711
FT                   /gene="IgH"
FT   intron          10712..10933
FT                   /gene="IgH"
FT                   /note="alpha-2 intron B"
FT   exon            10934..11328
FT                   /gene="IgH"
FT   variation       11141
FT                   /gene="IgH"
FT                   /note="t in A2m(1); a in A2m(2)"
FT   variation       11148
FT                   /gene="IgH"
FT                   /note="g in A2m(1); a in A2m(2)"
FT   variation       11172
FT                   /gene="IgH"
FT                   /note="c in A2m(1); t in A2m(2)"
FT   variation       11193
FT                   /gene="IgH"
FT                   /note="c in A2m(1); g in A2m(2)"
FT   variation       11260
FT                   /gene="IgH"
FT                   /note="t in A2m(1); a in A2m(2)"
FT   variation       11280..11281
FT                   /gene="IgH"
FT                   /note="tg in A2m(1); ca in A2m(2)"
FT   variation       11309..11313
FT                   /gene="IgH"
FT                   /note="tggac in A2m(1); cggat in A2m(2)"
FT   variation       11767
FT                   /note="c in A2m(1); t in A2m(2)"
FT   variation       12091
FT                   /note="a in A2m(1); c in A2m(2)"
FT   variation       12097
FT                   /note="c in A2m(1); g in A2m(2)"
XX
SQ   Sequence 12223 BP; 2378 A; 3688 C; 3507 G; 2014 T; 636 other;
     agctttctgg ggcgagccgg gcctgacttt ggctttgggg cagggagtgg gctaaggtga        60
     ggcaggtggc gccagccagg tgcacaccca atgcccgtga gcccagacac tggaccctgc       120
     ctggaccctc gtggatagac aagaaccgag gggcctctgc gcctgggccc agctctgtcc       180
     cacaccgcgg tcacatggca ccacctctct tgcagcctcc accaagggcc catcggtctt       240
     ccccctggcg ccctgctcca ggagcacctc cgagagcaca gccgccctgg gctgcctggt       300
     caaggactac ttccccgaac cggtgacggt gtcgtggaac tcaggcgctc tgaccagcgg       360
     cgtgcacacc ttcccagctg tcctacagtc ctcaggactc tactccctca gcagcgtggt       420
     gaccgtgccc tccagcaact tcggcaccca gacctacacc tgcaacgtag atcacaagcc       480
     cagcaacacc aaggtggaca agacagttgg tgagaggcca gctcagggag ggagggtgtc       540
     tgctggaagc caggctcagc cctcctgcct ggacgcaccc cggctgtgca gccccagccc       600
     agggcagcaa ggcaggcccc atctgtctcc tcacccggag gcctctgccc gccccactca       660
     tgctcaggga gagggtcttc tggctttttc caccaggctc caggcaggca caggctgggt       720
     gcccctaccc caggcccttc acacacaggg gcaggtgctt ggctcagacc tgccaaaagc       780
     catatccggg aggaccctgc ccctgaccta agccgacccc aaaggccaaa ctgtccactc       840
     cctcagctcg gacaccttct ctcctcccag atccgagtaa ctcccaatct tctctctgca       900
     gagcgcaaat gttgtgtcga gtgcccaccg tgcccaggta agccagccca ggcctcgccc       960
     tccagctcaa ggcgggacag gtgccctaga gtagcctgca tccagggaca ggccccagct      1020
     gggtgctgac acgtccacct ccatctcttc ctcagcacca cctgtggcag gaccgtcagt      1080
     cttcctcttc cccccaaaac ccaaggacac cctcatgatc tcccggaccc ctgaggtcac      1140
     gtgcgtggtg gtggacgtga gccacgaaga ccccgaggtc cagttcaact ggtacgtgga      1200
     cggcgtggag gtgcataatg ccaagacaaa gccacgggag gagcagttca acagcacgtt      1260
     ccgtgtggtc agcgtcctca ccgttgtgca ccaggactgg ctgaacggca aggagtacaa      1320
     gtgcaaggtc tccaacaaag gcctcccagc ccccatcgag aaaaccatct ccaaaaccaa      1380
     aggtgggacc cgcggggtat gagggccaca tggacagagg ccggctcggc ccaccctctg      1440
     ccctgggagt gaccgctgtg ccaacctctg tccctacagg gcagccccga gaaccacagg      1500
     tgtacaccct gcccccatcc cgggaggaga tgaccaagaa ccaggtcagc ctgacctgcc      1560
     tggtcaaagg cttctacccc agcgacatcg ccgtggagtg ggagagcaat gggcagccgg      1620
     agaacaacta caagaccaca cctcccatgc tggactccga cggctccttc ttcctctaca      1680
     gcaagctcac cgtggacaag agcaggtggc agcaggggaa cgtcttctca tgctccgtga      1740
     tgcatgaggc tctgcacaac cactacacgc agaagagcct ctccctgtct ccgggtaaat      1800
     gagtgccacg gccggcaagc ccccgctccc caggctctcg gggtcgcgtg aggatgcttg      1860
     gcacgtaccc cgtgtacata cttcccaggc acccagcatg gaaataaagc acccagcgct      1920
     gccctgggcc cctgcgagac tgtgatggtt ctttccgtgg gtcaggccga gtctgaggcc      1980
     tgagtggcat gagggaggca gagtgggtcn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnna gctttctggg gcaggccggg cctgactttg gctgggggca gggagggggc      2160
     taaggtgacg caggtggcgc cagccaggtg cacacccaat gcccatgagc ccagacactg      2220
     gaccctgcat ggaccatcgc ggatagacaa gaaccgaggg gcctctgcgc cctgggccca      2280
     gctctgtccc acaccgcggt cacatggcac cacctctctt gcagcttcca ccaagggccc      2340
     atccgtcttc cccctggcgc cctgctccag gagcacctcc gagagcacag ccgccctggg      2400
     ctgcctggtc aaggactact tccccgaacc ggtgacggtg tcgtggaact caggcgccct      2460
     gaccagcggc gtgcacacct tcccggctgt cctacagtcc tcaggactct actccctcag      2520
     cagcgtggtg accgtgccct ccagcagctt gggcacgaag acctacacct gcaacgtaga      2580
     tcacaagccc agcaacacca aggtggacaa gagagttggt gagaggccag cacagggagg      2640
     gagggtgtct gctggaagcc aggctcagcc ctcctgcctg gacgcacccc ggctgtgcag      2700
     ccccagccca gggcagcaag gcatgcccca tctgtctcct cacccggagg cctctgacca      2760
     ccccactcat gctcagggag agggtcttct ggatttttcc accaggctcc cggcaccaca      2820
     ggctggatgc ccctacccca ggccctgcgc atacagggca ggtgctgcgc tcagacctgc      2880
     caagagccat atccgggagg accctgcccc tgacctaagc ccaccccaaa ggccaaactc      2940
     tccactccct cagctcagac accttctctc ctcccagatc tgagtaactc ccaatcttct      3000
     ctctgcagag tccaaatatg gtcccccatg cccatcatgc ccaggtaagc caacccaggc      3060
     ctcgccctcc agctcaaggc gggacaggtg ccctagagta gcctgcatcc agggacaggc      3120
     cccagccggg tgctgacgca tccacctcca tctcttcctc agcacctgag ttcctggggg      3180
     gaccatcagt cttcctgttc cccccaaaac ccaaggacac tctcatgatc tcccggaccc      3240
     ctgaggtcac gtgcgtggtg gtggacgtga gccaggaaga ccccgaggtc cagttcaact      3300
     ggtacgtgga tggcgtggag gtgcataatg ccaagacaaa gccgcgggag gagcagttca      3360
     acagcacgta ccgtgtggtc agcgtcctca ccgtcctgca ccaggactgg ctgaacggca      3420
     aggagtacaa gtgcaaggtc tccaacaaag gcctcccgtc ctccatcgag aaaaccatct      3480
     ccaaagccaa aggtgggacc cacggggtgc gagggccaca cggacagagg ccagctcggc      3540
     ccaccctctg ccctgggagt gaccgctgtg ccaacctctg tccctacagg gcagccccga      3600
     gagccacagg tgtacaccct gcccccatcc caggaggaga tgaccaagaa ccaggtcagc      3660
     ctgacctgcc tggtcaaagg cttctacccc agcgacatcg ccgtggagtg ggagagcaat      3720
     gggcagccgg agaacaacta caagaccacg cctcccgtgc tggactccga cggctccttc      3780
     ttcctctaca gcaggctaac cgtggacaag agcaggtggc aggaggggaa tgtcttctca      3840
     tgctccgtga tgcatgaggc tctgcacaac cactacacac agaagagcct ctccctgtct      3900
     ctgggtaaat gagtgccagg gccggcaagc ccccgctccc cgggctctcg gggtcgcgcg      3960
     aggatgcttg gcacgtaccc cgtctacata cttcccaggc acccagcatg gaaataaagc      4020
     acccaccact gccctgggcc cctgtgagac tgtgatggtt ctttccacgg gtcaggccga      4080
     gtctgaggcc tgagtgacat gagggaggca gagcgggtcc cactgtcccc acactggnnn      4140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnngct tccacatttt caggtatcct      4260
     tatagcaatg ttccactcct caataccaat gttctgagtt agtctatttg tgttactaga      4320
     aaaaaaaaaa acatgaatct ggtaatttat aaagaaaaga ggtttgcacc aggcactgtg      4380
     gcaaggaagg gaggattaac tagctcacag ttctgcagcc attccggaaa cacggccctg      4440
     gcatctgctt ctggcgaggc ctcagggaga ttgcaatcac ggtagaaggc gaagggggag      4500
     caggcatgtc acatggcaag agggagcaag agaagagaag tggcacgtcc cagactttta      4560
     aacaatgagc tgtcacaggg actaactgag ggagaactcg ctcatcacct gggagatggt      4620
     gctaggccat tcatgagggg tccagcccca tgatctaatc acctcccacn annnncacct      4680
     ccaacactgg gaatcacatc tcaacatgaa atttggagag acacacatcc aaactattgc      4740
     accacaggaa gctggaagag gtggacggtc ctcccctgga gcactcagag acagccacca      4800
     acaccttgnt ctcagattcc tgactcccag aacnctgaaa anatttttgt tgttttaagc      4860
     cacatnnnna tattttgtta cggcagccac agcacgnnnn nnnntggcag agttctttag      4920
     cctccnnntg cancctgggg taaataacta ttgaatttgg ccacatggaa atcaggaaga      4980
     atgtaataag catcatgcnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5100
     cccaggcaac gggaccccaa gtttgctgac tgggaccacc aagcccnntg cgtcaagagt      5160
     gagagtccgg gacctaggca ggggccctgg ggttgggcct ggggggaccn tcccccagtc      5220
     actcggtgtg catcggtagt gaaggagcct cacctgaccc ccgctgttgc tcaatcgact      5280
     tcccaagaac agagagaaaa gggaacttcc aaggcggccc gggcctccgg gggttcccac      5340
     cccattttta gctgaaagca ctgaggcaga gctcnnnnnn nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5460
     nnnnnnnnnn nnnnagctta gctggttggg ctgagtaagc tgggctgagc taaatgggat      5520
     tgagctgagg agggctaggc tgggggagag acctgacgac ggacagggtt aaaagctgga      5580
     gtgagaggcc ttaaattatt gaactaaatt gggctggggt gatctgaatt tagctgggat      5640
     gagctgggnn nnnnngggct gtgcccacgc gagctgggct aagctaggct cgcctgagtg      5700
     gactcagctg ggttggtctc aactactggg ttcagctggg ctgggctgag ctaggttaga      5760
     ctggggaagg ctgggctggg tcgggctggg ttgggctggg ctgctcaagg ctaagctaac      5820
     ctaacctaac ctgggttcag ctggcctagg ttgggctggg ttgggctaag ctgggttcag      5880
     ctgagatatg ctaatatggg ctgggctggg tcaggttgag gttaactgaa ctgggctgac      5940
     ctgggctgag ctcaactgag ttcacatggg ctgggctggc ctggcctggc ctaaactggg      6000
     tttggctggg ctgggccaac tggactgagg tggatggagc tgggctgagc tggcctggcc      6060
     gggcctcagc tgtgattgga agacctgggc tggagctgga cagacctgag ccaagcttnn      6120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnngc tggactgggc tgagctagac      6240
     tgggcaactg tattcagctg ggctggcctg gcctcggctg ggctgggttc agctgggctg      6300
     ggctgagcag gcctgagcag gattagttga gctggtcgta actggattta actagctagg      6360
     ctaggcttaa ctgactaagc tgatctggac tgtattcatc tggatgaagc tggggtgagg      6420
     tggctacttt aggtcagctt tgctgagcta aactggaccg ggctaaattg atctggactg      6480
     accattctca cctggctaag aggagctgag tcagaagcaa gctggttgag ctggctggac      6540
     tgaaataaga gtttgctgcc tgcaagggga ggtcctgggc tgacctgggc caggctgaac      6600
     caggctggct tagagtgaac ttcagagggc gactcccccg gtaggccagt ctcagctgaa      6660
     cttggctgtc ccggtgggca gagcggggct ggatactgtg attttggggg tacctagagc      6720
     agacttcaag accaagctaa actgggctcc aggggcagga tgggctgggg acttgggact      6780
     ccaggccagg ggcgaagggc cacgctgtac agaccgcact atctgggcca gggttctgtg      6840
     gtgggaggga ctgactgcct ggggcatcag ggcaagtctt cccgccctcc cctagaggtc      6900
     aggggtgggc agagcaccat gggggtctgg caggtcaggt gagggctgct gtgatgggga      6960
     gatccaggct tggcactcaa gagcccgagg agctgagacc acagccttgg ggggttgggg      7020
     tcagggttgg agggcaggca gaccatccac catgagccca gagagagttt gaagggggag      7080
     ggctctgggg tccggcccat ggggtccctg ggtttcagcc taggggcatg gcccagtgtc      7140
     tctgctcctg agtgcccacc gtgcagcact tgcaggggga ggctggggtc atcctggagg      7200
     cacccccctt cctgagccca gcctgatgat agtggctgag caacagcttc tggtggggga      7260
     atgggccctg ggagccgccc tgggcctggg gattgtgggg aaaaaggccc agaatgagcc      7320
     tagccatctg gatccctgcc acggggtccc cagctccccc atccaggccc cccaggcctg      7380
     atgggcgctg gcctgaggct ggcactgact aggttctgtc ctcacagcct ccacacagag      7440
     cccatccgtc ttccccttga cccgctgctg caaaaacatt ccctccaatg ccacctccgt      7500
     gactctgggc tgcctggcca cgggctactt cccggagccg gtgatggtga cctgcgacac      7560
     aggctccctc aacgggacaa ctatgacctt accagccacc accctcacgc tctctggtca      7620
     ctatgccacc atcagcttgc tgaccgtctc gggtgcgtgg gccaagcaga tgttcacctg      7680
     ccgtgtggca cacactccat cgtccacaga ctgggtcgac aacaaaacct tcagcggtaa      7740
     gagagggcca agctcagaga ccacagttcc caggagtgcc aggctgaggg ctggcagagt      7800
     gggcaggggt tgagggggtg ggtgggctca aacgtgggaa cacccagcat gcctggggac      7860
     ccgggccagg acgtgggggc aagaggaggg cacacagagc tcagagaggc caacaaccct      7920
     catgaccacc agctctcccc cagtctgctc cagggacttc accccgccca ccgtgaagat      7980
     cttacagtcg tcctgcgacg gcggcgggca cttccccccg accatccagc tcctgtgcct      8040
     cgtctctggg tacaccccag ggactatcaa catcacctgg ctggaggacg ggcaggtcat      8100
     ggacgtggac ttgtccaccg cctctaccac gcaggagggt gagctggcct ccacacaaag      8160
     cgagctcacc ctcagccaga agcactggct gtcagaccgc acctacacct gccaggtcac      8220
     ctatcaaggt cacacctttg aggacagcac caagaagtgt gcaggtacgt tcccacctgc      8280
     cctggtggcc gccacggagg ccagagaaga ggggcgggtg ggcctcacac agccctccgg      8340
     tgtaccacag attccaaccc gagaggggtg agcgcctacc taagccggcc cagcccgttc      8400
     gacctgttca tccgcaagtc gcccacgatc acctgtctgg tggtggacct ggcacccagc      8460
     aaggggaccg tgaacctgac ctggtcccgg gccagtggga agcctgtgaa ccactccacc      8520
     agaaaggagg agaagcagcg caatggcacg ttaaccgtca cgtccaccct gccggtgggc      8580
     acccgagact ggatcgaggg ggagacctac cagtgcaggg tgacccaccc ccacctgccc      8640
     agggccctca tgcggtccac gaccaagacc agcggtgagc catgggcagg ccggggtcgt      8700
     gggggaaggg agggagcgag tgagcggggc ccgggctgac cccacgtctg gccacaggcc      8760
     cgcgtgctgc cccggaagtc tatgcgtttg cgacgccgga gtggccgggg agccgggaca      8820
     agcgcaccct cgcctgcctg atccagaact tcatgcctga ggacatctcg gtgcagtggc      8880
     tgcacaacga ggtgcagctc ccggacgccc ggcacagcac gacgcagccc cgcaagacca      8940
     agggctccgg cttcttcgtc ttcagccgcc tggaggtgac cagggccgaa tgggagcaga      9000
     aagatgagtt catctgccgt gcagtccatg aggcagcgag cccctcacag accgtccagc      9060
     gagcggtgtc tgtaaatccc ggtaaatgac gtactcctgc ctccctccct cccagggctc      9120
     catccagctg tgcagtgggg aggactggcc agaccttctg tccactgttg caatgacccc      9180
     aggaagctac ccccaataaa ctgtgcctgc tcagagcccc aggtacaccc attcttggga      9240
     gcgggcaggg ctgtgggcag gtgcatcttg gcacagagga atggccccca ggaggggcag      9300
     tgggaggagg tgggcagggc tgagcccccc ctggagaggc ggtgggagga ggtgggcagg      9360
     gctgaggtgc cactcatcca tctgccttcg tgtcagggtt atttgtcaaa cagcatatct      9420
     gcagggactc atcacagcta ccccgggccc tctctgcccc cactctgggt ctaccccctc      9480
     caaggagtcc aaagacccag gggaggtcct cagggaaggg gcaagggagc ccacagccct      9540
     ctctcttggg ggcttggctt ctacccccct ggacaggagc ccctgcaccc ccaggtatag      9600
     atgggcannn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnggt ccaaccgcag      9720
     gcccatggtg caggagctgt gtaacctatg gggctgtcac caggcctctc tgtgctgggt      9780
     tcctccagtg tagaggagag gcaggtacag cctgtcctcc tggggacatg gcatgagggc      9840
     cgcgtcctca cagcgcattc tgtgttccag catccccgac cagccccaag gtcttcccgc      9900
     tgagcctcga cagcaccccc caagatggga acgtggtcgt cgcatgcctg gtccagggct      9960
     tcttccccca ggagccactc agtgtgacct ggagcgaaag cggacagaac gtgaccgcca     10020
     gaaacttccc acctagccag gatgcctccg gggacctgta caccacgagc agccagctga     10080
     ccctgccggc cacacagtgc ccagacggca agtccgtgac atgccacgtg aagcactaca     10140
     cgaatcccag ccaggatgtg actgtgccct gcccaggtca gagggcaggc tggggagtgg     10200
     ggcggggcca ccccgtcctg ccctgacact gcgcctgcac ccgtgttccc cacagggagc     10260
     cgccccttca ctcacaccag agtggacccc gggccgagcc ccaggaggtg gtggtggaca     10320
     ggccaggagg ggcgaggcgg gggcacgggg aagggcgttc tgaccagctc aggccatctc     10380
     tccactccag ttcccccacc tcccccatgc tgccaccccc gactgtcgct gcaccgaccg     10440
     gccctcgagg acctgctctt aggttcagaa gcgaacctca cgtgcacact gaccggcctg     10500
     agagatgcct ctggtgccac cttcacctgg acgccctcaa gtgggaagag cgctgttcaa     10560
     ggaccacctg agcgtgacct ctgtggctgc tacagcgtgt ccagtgtcct gcctggctgt     10620
     gcccagccat ggaaccatgg ggagaccttc acctgcactg ctgcccaccc cgagttgaag     10680
     accccactaa ccgccaacat cacaaaatcc ggtgggtcca gaccctgctc ggggccctgc     10740
     tcagtgctct ggtttgcaaa gcatattccc ggcctgcctc ctccctccca atcctgggct     10800
     ccagtgctca tgccaagtac acagggaaac tgaggcaggc tgaggggcca ggacacagcc     10860
     cagggtgccc accagagcag aggggctctc tcatcccctg cccagccccc tgacctggct     10920
     ctctaccctc caggaaacac attccggccc gaggtccacc tgctgccgcc gccgtcggag     10980
     gagctggccc tgaacgagct ggtgacgctg acgtgcctgg cacgtggctt cagccccaag     11040
     gatgtgctgg ttcgctggct gcaggggtca caggagctgc cccgcgagaa gtacctgact     11100
     tgggcatccc ggcaggagcc cagccagggc accaccacct tcgctgtgac cagcatactg     11160
     cgcgtggcag ccgaggactg gaagaagggg gacaccttct cctgcatggt gggccacgag     11220
     gccctgccgc tggccttcac acagaagacc atcgaccgct tggcgggtaa acccacccat     11280
     gtcaatgtgt ctgttgtcat ggcggaggtg gacggcacct gctactgagc cgcccgcctg     11340
     tccccacccc tgaataaact ccatgctccc ccaagcagcc ccacgcttcc atccggcgcc     11400
     tgtctgtcca tcctcagggt ctcagcactt gggaaagggc cagggcatgg acagggaaga     11460
     ataccccctg ccctgagcct cggggggccc ctggcacccc catgagactt tccaccctgg     11520
     tgtgagtgtg agttgtgagt gtgagagtgt gtggtgcagg aggcctcgct ggtgtgagat     11580
     cttaggtctg ccaaggcagg cacagcccag gatgggttct gagagacgca catgccccgg     11640
     acagttctga gtgagcagtg gcatggccgt ttgtccctga gagagccgcc tctggctgta     11700
     gctgggaggg aatagggagg gtaaaaggag caggctagcc aagaaaggcg caggtagtgg     11760
     caggagcggc gagggagtga ggggctggac tccagggccc cactgggagg acaagctcca     11820
     ggagggcccc accaccctag tgggtgggcc tcaggacgtc ccactgacgc atgcaggaag     11880
     gggcacctcc ccttaaccac actgctctgt acggggcacg tgggcacaca tgcacactca     11940
     cactcacata tacgcctgag ccctgcagga gtggaacgtt cacagcccag acccagttcc     12000
     agaaaagcca ggggagtccc ctcccaagcc cccaagctca gcctgctccc ccaggcccct     12060
     ctggcttccc tgtgtttcca ctgtgcacag atcaggcacc aactccacag acccctccca     12120
     ggcagcccct gctccctgcc tggccaagtc tcccatccct tcctaagccc aactaggacc     12180
     caaagcatag acagggaggg gccgcgtggg gtggcatcag aag                       12223
//