spacer

EBI Dbfetch

ID   JX988608; SV 1; linear; genomic DNA; STD; HUM; 1370 BP.
XX
AC   JX988608;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*03:04 allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1370
RA   Hodges E., Tian R., DeOliveira A., Chen D.;
RT   "Identification of HLA-C*03:04 novel allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1370
RA   Hodges E., Tian R., DeOliveira A., Chen D.;
RT   ;
RL   Submitted (19-OCT-2012) to the INSDC.
RL   Clinical Transplantation Immunology Laboratory, Duke University Medical
RL   Center, Research Parks Building, Room 116, Durham, NC 27710, USA
XX
DR   MD5; 3710c321a5e21569ff75a35d38a510f1.
DR   IMGT/HLA; C*03:183; HLA08954.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SeqPilot v. 3.1
CC   Coverage              :: exon 1-4
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1370
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1370
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT   mRNA            join(<1..73,204..473,719..994,1095..>1370)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,719..994,1095..>1370)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:L0GE50"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L0GE50"
FT                   /protein_id="AGA83418.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVDQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /number=1
FT   gap             74..203
FT                   /estimated_length=130
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /number=2
FT   gap             474..718
FT                   /estimated_length=245
FT   exon            719..994
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /number=3
FT   gap             995..1094
FT                   /estimated_length=unknown
FT   exon            1095..1370
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:04"
FT                   /number=4
XX
SQ   Sequence 1370 BP; 180 A; 274 C; 311 G; 130 T; 475 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     tcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnngg       720
     tctcacatca tccagaggat gtatggctgc gacgtggggc ccgacgggcg cctcctccgc       780
     gggtatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc       840
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac       960
     ctgaagaatg ggaaggagac gctgcagcgc gcggnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnaacacc caaagacaca cgtgacccac catcccgtct ctgaccatga      1140
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca      1200
     gtgggatggg gaggaccaaa ctcaggacac tgagcttgtg gagaccaggc cagcaggaga      1260
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac      1320
     gtgccatgtg cagcacgagg ggctgccgga gcccctcacc ctgagatggg                 1370
//


spacer
spacer