spacer

EBI Dbfetch

ID   JX974835; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   JX974835;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   23-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*16:var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Zollikofer C., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (15-OCT-2012) to the INSDC.
RL   IKT Ulm, Transplantation Immunology, Helmholtzstrasse 10, Ulm,
RL   Baden-Wurttemberg 89075, Germany
XX
DR   MD5; d9e847b4e605f64cdb6c68ccf0d1611e.
DR   IMGT/HLA; C*16:54; HLA08892.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16:var"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16:var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16:var"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen C"
FT                   /db_xref="GOA:L7UNT4"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L7UNT4"
FT                   /protein_id="AGC51041.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGLTPSSGCMAATWGP
FT                   TGGLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEDTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 106 A; 173 C; 198 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gtctcacacc ctccagtgga tgtatggctg cgacctgggg cccgacgggc       420
     ggcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgcggcgga gcagcagaga gcctacctgg aggacacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer