Dbfetch

ID   JX974834; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   JX974834;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   23-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*01:var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Zollikofer C., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (15-OCT-2012) to the INSDC.
RL   IKT Ulm, Transplantation Immunology, Helmholtzstrasse 10, Ulm,
RL   Baden-Wurttemberg 89075, Germany
XX
DR   MD5; 72c84c22935e926098219efe91d1dd4b.
DR   IMGT/HLA; A*01:124; HLA08920.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:var"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:var"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen A"
FT                   /db_xref="GOA:L7UPW6"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L7UPW6"
FT                   /protein_id="AGC51040.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQLT"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 112 A; 164 C; 194 G; 76 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggtcc atgcggcgga gcagcggaga gtctacctgg agggccggtg cgtggacggg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc tcacgg                      646
//