spacer

EBI Dbfetch

ID   JX961659; SV 1; linear; genomic DNA; STD; HUM; 1258 BP.
XX
AC   JX961659;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I chain-related protein A (HLA-MICA) gene,
DE   HLA-MICA*008:01:01new allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1258
RX   DOI; 10.1111/tan.12169.
RX   PUBMED; 24032736.
RA   Du Z.H., Jiao S.X., Du B., Liu X.H., Wu Z.J.;
RT   "Identification of a novel allele MICA*008:05 by sequence-based typing";
RL   Tissue Antigens 82(3):217-218(2013).
XX
RN   [2]
RP   1-1258
RA   Du Z., Jiao S., Liu X., Wu Z.;
RT   ;
RL   Submitted (09-OCT-2012) to the INSDC.
RL   HLA-Typing Laboratory, Qingdao Central Blood Station, No. 9 Longde Road,
RL   Qingdao, Shandong 266071, China
XX
DR   MD5; a48378e9209e34c043a98e8aabf6cb0e.
DR   Ensembl-Gn; ENSG00000204520; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233051; homo_sapiens.
DR   Ensembl-Tr; ENST00000415525; homo_sapiens.
DR   Ensembl-Tr; ENST00000427477; homo_sapiens.
DR   Ensembl-Tr; ENST00000449934; homo_sapiens.
DR   Ensembl-Tr; ENST00000546529; homo_sapiens.
DR   Ensembl-Tr; ENST00000547767; homo_sapiens.
DR   IMGT/HLA; MICA*008:05; HLA08919.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1258
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1258
FT                   /gene="HLA-MICA"
FT                   /allele="HLA-MICA*008:01:01new"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1229)
FT                   /gene="HLA-MICA"
FT                   /allele="HLA-MICA*008:01:01new"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..1022,1123..1229)
FT                   /codon_start=3
FT                   /gene="HLA-MICA"
FT                   /allele="HLA-MICA*008:01:01new"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="leukocyte antigen"
FT                   /db_xref="GOA:L0L8F7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:L0L8F7"
FT                   /protein_id="AGB57986.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAGCCYFCYYYFLCPLL"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   gap             644..743
FT                   /estimated_length=unknown
FT   gap             1023..1122
FT                   /estimated_length=unknown
XX
SQ   Sequence 1258 BP; 241 A; 243 C; 269 G; 205 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc tggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc gaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tggctgctgc tatttttgtt      1200
     attattattt tctatgtccg ttgttgtaag aagaaaacat cagctgcaga gggtccag        1258
//


spacer
spacer