spacer

EBI Dbfetch

ID   JX915742; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   JX915742;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*01:02 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/tan.12107.
RX   PUBMED; 23535199.
RA   Tao S.D., Zhang W., Zhu F.M., He J., Lv H.J.;
RT   "A novel HLA allele, HLA-C*01:02:18, was identified by polymerase chain
RT   reaction sequence-based typing in a Chinese leukemia patient";
RL   Tissue Antigens 82(1):65-66(2013).
XX
RN   [2]
RP   1-1022
RA   Zhu F., Wang W., He J.;
RT   "A novel HLA-C*01:02 allele was identified";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Zhu F., Wang W., He J.;
RT   ;
RL   Submitted (09-OCT-2012) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 3cd941b788a885422ab53c0618828ed0.
DR   IMGT/HLA; C*01:02:18; HLA08885.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="p6479"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01:02"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01:02"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01:02"
FT                   /product="MHC class I antigen"
FT                   /note="HLA antigen"
FT                   /db_xref="GOA:L0GD23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L0GD23"
FT                   /protein_id="AGA84613.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             647..746
FT                   /estimated_length=unknown
XX
SQ   Sequence 1022 BP; 170 A; 250 C; 286 G; 116 T; 200 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac tgccgcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagtgggatg gggaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg atggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg tgcagcacga ggggctgccg gagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer