Dbfetch

ID   JX898532; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX898532;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens isolate 2012-2280 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1-DRB1*13:154 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12168.
RX   PUBMED; 24032731.
RA   Barbuti S., Putignano A.L., Rombola G., Marchetti L., Curcio M.,
RA   Scatena F.;
RT   "Identification of a novel HLA-DRB1*13 variant allele: DRB1*13:154";
RL   Tissue Antigens 82(3):210-211(2013).
XX
RN   [2]
RP   1-270
RA   Barbuti S., Putignano A.L., Rombola' G., Marchetti L., Vittorio O.,
RA   Curcio M., Genuardi M., Scatena F.;
RT   ;
RL   Submitted (03-OCT-2012) to the INSDC.
RL   Immunoematologia, Azienda Ospedaliera-Universitaria Pisana, via Paradisa,
RL   Pisa 56100, Italy
XX
DR   MD5; d07d8673a5c858a223f92cc6c9a8e00d.
DR   IMGT/HLA; DRB1*13:154; HLA08887.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="2012-2280"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13:154"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13:154"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13:154"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:L0HNF8"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L0HNF8"
FT                   /protein_id="AGB06283.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 95 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//