spacer

EBI Dbfetch

ID   JX898531; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX898531;
XX
DT   28-DEC-2012 (Rel. 115, Created)
DT   28-DEC-2012 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens isolate 2011-2616 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1-DRB1*01:54 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Barbuti S.;
RT   "Sequence-based typing confirmed a new HLA-DRB1 allele, DRB1*01:54";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Barbuti S., Marchetti L., Vittorio O., Fornaciari S., Mariotti M.L.,
RA   Sciarrino R., Curcio M., Scatena F.;
RT   ;
RL   Submitted (03-OCT-2012) to the INSDC.
RL   Immunoematologia, Azienda Ospedaliera-Universitaria Pisana, via Paradisa,
RL   Pisa 56100, Italy
XX
DR   MD5; 288a39641557d5d60776b4269024a8b9.
DR   IMGT/HLA; DRB1*01:54; HLA08886.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="2011-2616"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*01:54"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*01:54"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*01:54"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:L0HR21"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L0HR21"
FT                   /protein_id="AGB06282.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQRRAAVDTYCRHNYGAVESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 61 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcagagg cgggccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer