spacer

EBI Dbfetch

ID   JX826590; SV 1; linear; genomic DNA; STD; HUM; 3055 BP.
XX
AC   JX826590;
XX
DT   19-NOV-2012 (Rel. 114, Created)
DT   19-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*80:01 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3055
RA   Balas A., Vicario J.L.;
RT   "Genomic full length sequence of HLA-A*80:01 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-3055
RA   Balas A., Vicario J.L.;
RT   ;
RL   Submitted (14-SEP-2012) to the INSDC.
RL   Histocompatibility, Histocompatibility. Regional Transfusion Centre of
RL   Madrid, Avenida de la Democracia S/N, Madrid, Madrid 28032, Spain
XX
DR   MD5; 5cc77fd13bd6123b7300d6da19ae5c13.
DR   IMGT/HLA; A*80:01:01:02; HLA08791.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3055
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>3055
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80:01"
FT   mRNA            join(1..223,354..623,865..1140,1723..1998,2101..2217,
FT                   2660..2692,2835..2882,3051..>3055)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80:01"
FT                   /product="MHC class I antigen"
FT   5'UTR           1..150
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80:01"
FT   CDS             join(151..223,354..623,865..1140,1723..1998,2101..2217,
FT                   2660..2692,2835..2882,3051..3055)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*80:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:K7WT83"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:K7WT83"
FT                   /protein_id="AFW99834.1"
FT                   /translation="MAVMPPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDSQFVQFDSDAASQRMEPRAPWIEQEEPEYWDEETRNVKAHSQTNRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAARRAEQLRAYLEGECVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEKRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIIAGLVLLGAVIAGAVVAAVMWRKKSSVRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 3055 BP; 593 A; 885 C; 948 G; 629 T; 0 other;
     ggtccttctt cctggatact cacgacgcgg acccagttct cactcctatt gggtgtcggg        60
     tttccagaga agccaatcag tgtcgtcgcg gtcgcggttc taaagtccgc acgcacccac       120
     cgggactcag attctcccca gacgccgagg atggccgtca tgccgccccg aaccctcctc       180
     ctgctactct cgggggccct ggccctgacc cagacctggg caggtgagtg cggggtcggg       240
     agggaaacgg cctctgcggg gagaagcaag gggcccgccc ggcgggggcg caggacccgg       300
     gaagccgcgc cgggaggagg gtcgggcggg tctcagccac tcctcgcccc caggctccca       360
     ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc cccgcttcat       420
     cgcagtgggc tacgtggacg actcgcagtt cgtgcagttc gacagcgacg ccgcgagcca       480
     gaggatggag ccgcgggcgc cgtggataga gcaggaggag ccggagtatt gggacgagga       540
     gacacggaat gtgaaggccc actcacagac taaccgagcg aacctgggga ccctgcgcgg       600
     ctactacaac cagagcgagg acggtgagtg accccggccc ggggcgcagg tcacgacccc       660
     tcatccccta cggacgggcc aggtcgccca cagtctccgg gtccgagatc caccccgaag       720
     ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgcctttagc cggtttcatt       780
     ttcagtttag gccaaaaatc cccccgggtg ggtcggggcg gggcggggct cgggggaccg       840
     ggctgaccgc ggggtcgggg ccaggttctc acaccatcca gataatgtat ggctgcgacg       900
     tggggtcgga cgggcgcttc ctccgcgggt accggcagga cgcctacgac ggcaaggatt       960
     acatcgccct gaacgaggac ctgcgctctt ggaccgcggc ggacatggcg gctcagatca      1020
     ccaagcgcaa gtgggaggcg gcccgtcggg cggagcagct gagagcctac ctggagggcg      1080
     agtgcgtgga cgggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcacgg      1140
     gtaccagggg ccacggggcg ccttcctgat cgcctgtaga tctcccgggc tggcctccca      1200
     caaggagggg agacaattgg gaccaacact agaatatcac cctccctctg ctcctgaggg      1260
     agaggaatcc tcctgggttt ccagattctg taccagagag tgactctgag gttccgccct      1320
     gctctctgac acaattaagg gataaaaatc tctgaaggaa tgacgggaag acgatccctc      1380
     gaatactgat gagtggttcc ctttgacaca caccggcggc agccttgggc ccgtgacttt      1440
     tcctctcagg ccctgttctc tgcttcacac tcaatatgtg tgggggtctg agtccagcac      1500
     ttctgagtct ctcagcctcc actcaggtca ggaccagaag tcgctgttcc ctcgtcaggg      1560
     aatagaagat tatcccaggt gcctgtgtcc aggctggtct gggttctgtg ctctcttccc      1620
     catcccaggt gtcctgtcca tcctcaaaat ggccacatgc gtgctggtgg agtgtcccat      1680
     gacagatgca aaatggctga attttctgac tcttcccgtc agaccccccc aagacacata      1740
     tgacccacca ccccatctct gaccatgagg ccactctgag gtgctgggcc ctgagcttct      1800
     accctgcgga gatcacactg acctggcagc gggatgggga ggaccagacc caggacacgg      1860
     agctcgtgga gaccaggcct gcaggggatg gaaccttcca gaagtgggcg gctgtggtgg      1920
     taccttctgg aaaggagaag agatacacct gccatgtgca gcatgagggt ctgcccgagc      1980
     ccctcaccct gagatggggt aaggagggag atgggggtgt catgtctctt agggaaagca      2040
     ggagcctctc tggagacctt tagcagggtc agagcccctc accttcccct cttttcccag      2100
     agccatcttc ccagcccacc atccccattg tgggcatcat tgctggcctg gttctccttg      2160
     gagctgtgat cgctggagct gtggtcgctg ccgtgatgtg gaggaagaag agctcaggtg      2220
     gagaaggggt gaagggtggg gtctgagatt tcttgtctca ctgagggttc caagccccag      2280
     ctagaaatgt gccctgtctc attcctggga agcaccaccc acaatcatgg gcccacccag      2340
     cctgggccct gtgtgccagc acttactctt ttgtaaagca cctgtgacaa tgaaggacag      2400
     atttatcacc ttgattatgg cggtgatggg acctgatccc agcagtcaca agtcacaggg      2460
     gaaggtccct gaggacagac ctcaggaggg cggttggtcc aggacccaca cctgctttct      2520
     tcatgtttcc tgatcctgcc ctgggtctgc attcacacat ttctggaaac ttctctgggg      2580
     tccaaggcta cgaggttcct ctaggacctt aaggccctgg ctcctttctg gtagctcaca      2640
     ggacattttc ttcccacagt tagaaaagga gggagctact ctcaggctgc aagtaagtat      2700
     gaaggaggct gatgcctgag gtccttggga tattgtggtt gggagcccat gggggagctc      2760
     acccacccca caattcctcc tctagccaca tcttctgtgg gatctgacca ggttctgttt      2820
     ttgttctacc ccaggcagtg acagtgccca gggctctgat gtgtctctca cagcttgtaa      2880
     aggtgagagc ctggagggcc tgatgtgtgt tgggtgttgg ggggaacagt ggacacagct      2940
     gtgctatggg gtttctttgc attggatgta ttgagcatgc gatgggctgt ttaaagtgtg      3000
     acccctcact gtgagtgata tgaatttgtt catgaatatt ttttctatag tgtga           3055
//


spacer
spacer