spacer

EBI Dbfetch

ID   JX674064; SV 2; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   JX674064;
XX
DT   27-NOV-2012 (Rel. 114, Created)
DT   05-MAR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51:01:01 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-788
RA   Lazaro A.M., Hurley C.K.;
RT   ;
RL   Submitted (11-SEP-2012) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
RN   [2]
RC   Sequence update by submitter
RP   1-788
RA   Lazaro A.M., Hurley C.K.;
RT   ;
RL   Submitted (04-MAR-2013) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; a3ab362bb6d440f97e563f5191eed985.
DR   IMGT/HLA; B*51:149N; HLA08910.
XX
CC   On Mar 4, 2013 this sequence version replaced gi:423091327.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>788
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:01:01 variant"
FT   mRNA            join(<1..270,516..>788)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:01:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>788)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51:01:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:K7YQA9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:K7YQA9"
FT                   /protein_id="AFX84029.2"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLRA"
FT   gap             271..515
FT                   /estimated_length=245
XX
SQ   Sequence 788 BP; 114 A; 171 C; 185 G; 73 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaagat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcgcgcgg                                                                788
//


spacer
spacer