Dbfetch

ID   JX564252; SV 1; linear; genomic DNA; STD; HUM; 3116 BP.
XX
AC   JX564252;
XX
DT   14-APR-2013 (Rel. 116, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24:215 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3116
RX   DOI; 10.1111/tan.12161.
RX   PUBMED; 23849071.
RA   Plaisier L., Geerts N., van Ginkel W., van der Weerd R., Spierings E.;
RT   "The novel HLA-A*24:215 allele, identified by sequencing-based typing of a
RT   stem cell transplant patient and the sibling donor";
RL   Tissue Antigens 82(2):138-139(2013).
XX
RN   [2]
RP   1-3116
RA   Plaisier L., Geerts N., van Ginkel W., van der Weerd R., Spierings E.;
RT   ;
RL   Submitted (31-AUG-2012) to the INSDC.
RL   Immunology, UMC Utrecht, Heidelberglaan 100, Utrecht, Utrecht 3584CX, The
RL   Netherlands
XX
DR   MD5; f6c6ec83d1c70ef4bdc483abf45a141c.
DR   IMGT/HLA; A*24:215; HLA08602.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SBT engine v. 2.19.0.0
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3116
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <13..>2914
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:215"
FT   mRNA            join(<13..85,216..485,727..1002,1582..1857,1960..2076,
FT                   2519..2551,2694..2741,2910..>2914)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:215"
FT                   /product="MHC class I antigen"
FT   CDS             join(13..85,216..485,727..1002,1582..1857,1960..2076,
FT                   2519..2551,2694..2741,2910..2914)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:215"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:M9QZ33"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:M9QZ33"
FT                   /protein_id="AGI65159.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKEMLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 3116 BP; 605 A; 897 C; 959 G; 655 T; 0 other;
     cagacgccga ggatggccgt catggcgccc cgaaccctcg tcctgctact ctcgggggcc        60
     ctggccctga cccagacctg ggcaggtgag tgcggggtcg ggagggaaac ggcctctgcg       120
     gggagaagca aggggcccgc ctggcggggg cgcaagaccc gggaagccgc gccgggagga       180
     gggtcgggcg ggtctcagcc actcctcgtc cccaggctcc cactccatga ggtatttctc       240
     cacatccgtg tcccggcccg gccgcgggga gccccgcttc atcgccgtgg gctacgtgga       300
     cgacacgcag ttcgtgcggt tcgacagcga cgccgcgagc cagaggatgg agccgcgggc       360
     gccgtggata gagcaggagg ggccggagta ttgggacgag gagacaggga aagtgaaggc       420
     ccactcacag actgaccgag agaacctgcg gatcgcgctc cgctactaca accagagcga       480
     ggccggtgag tgaccccggc ccggggcgca ggtcacgacc cctcatcccc cacggacggg       540
     ccgggtcgcc cacagtctcc gggtccgaga tccaccccga agccgcggga ccccgagacc       600
     cttgccccgg gagaggccca ggcgccttaa cccggtttca ttttcagttt aggccaaaaa       660
     tccccccggg ttggtcgggg ccgggcgggg ctcgggggac tgggctgacc gcggggtcgg       720
     ggccaggttc tcacaccctc cagatgatgt ttggctgcga cgtggggtcg gacgggcgct       780
     tcctccgcgg gtaccaccag tacgcctacg acggcaagga ttacatcgcc ctgaaagagg       840
     acctgcgctc ttggaccgcg gcggacatgg cggctcagat caccaagcgc aagtgggagg       900
     cggcccatgt ggcggagcag cagagagcct acctggaggg cacgtgcgtg gacgggctcc       960
     gcagatacct ggagaacggg aaggagatgc tgcagcgcac gggtaccagg ggccacgggg      1020
     cgcctacctg atcgcctgta ggtctcccgg gctggcctcc cacaaggagg ggagacaatt      1080
     gggaccaaca ctagaatatc gccctccctc tggtcctgag ggagaggaat cctcctgggt      1140
     ttccagatcc tgtaccagag agtgactctg aggttccgcc ctgctctctg acacaattaa      1200
     gggataaaat ctctgacgga atgacggaaa gacgatccct cgaatactga tgactggttc      1260
     cctttgacac cggcagcagc cttgggaccg tgacttttcc tctcaggcct tgttctctgc      1320
     ttcacactca atgtgtgtgg gggtctgagt ccagcacttc tgagtccctc agcctccact      1380
     caggtcagga ccagaagtcg ctgttccctc ctcagggaat agaagattat cccaggtgcc      1440
     tgtgtccagg ctggtgtctg ggttctgtgc tctcttcccc atcccgggtg tcctgtccat      1500
     tctcaagatg gccacatgca tgctggtgga gtgtcccatg acagatgcaa aatgcctgaa      1560
     ttttctgact cttcccgtca gaccccccca agacacatat gacccaccac cccatctctg      1620
     accatgaggc cactctgaga tgctgggccc tgggcttcta ccctgcggag atcacactga      1680
     cctggcagcg ggatggggag gaccagaccc aggacacgga gcttgtggag accaggcctg      1740
     caggggatgg aaccttccag aagtgggcag ctgtggtggt accttctgga gaggagcaga      1800
     gatacacctg ccatgtgcag catgagggtc tgcccaagcc cctcaccctg agatggggta      1860
     aggagggaga tgggggtgtc atgtctctta gggaaagcag gagcctctct ggagaccttt      1920
     agcagggtca gggcccctca ccttcccctc ttttcccaga gccatcttcc cagcccaccg      1980
     tccccatcgt gggcatcatt gctggcctgg ttctccttgg agctgtgatc actggagctg      2040
     tggtcgctgc tgtgatgtgg aggaggaaca gctcaggtgg agaaggggtg aagggtgggg      2100
     tctgagattt cttgtctcac tgagggttcc aagccccagc tagaaatgtg ccctgtctca      2160
     ttactgggaa gcaccatcca caatcatggg ccgacccagc ctgggccctg tgtgccagca      2220
     cttactcttt tgtaaagcac ctgtgacaat gaaggacaga tttatcacct tgattatggc      2280
     ggtgatggga cctgatccca gcagtcacaa gtcacagggg aaggtccctg acgacagatc      2340
     tcaggagggc gattggtcca gggcccacat ctgctttctt catgtttcct gatcctgccc      2400
     tgggtctgca gtcacacatt tctggaaact tctctggggt ccaagactag gaggttcctc      2460
     taggacctta aggccctggc tcctttctgg tatctcacag gacattttct tcccacagat      2520
     agaaaaggag ggagctactc tcaggctgca agtaagtatg aaggaggctg atgcctgagg      2580
     tccttgggat attgtgtttg ggagcccatg ggggagctca accaccccac aattcctcct      2640
     ctagccacat cttctgtggg atctgaccag gttctgtttt tgttctaccc caggcagtga      2700
     cagtgcccag ggctctgatg tgtctctcac agcttgtaaa ggtgagagct tggagggcct      2760
     gatgtgtgtt gggtgttggg cggaacagtg gacacagctg tgctatgggg tttctttgca      2820
     ttggatgtat tgagcatgcg atgggctgtt taaagtgtga cccctcactg tgacagatat      2880
     gaagttgttc atgaattttt tttctatagt gtgagacagc tgccttgtgt gggactgaga      2940
     ggcaagagtt gttcctgccc ttccctttgt gacttgaaga accctgactt tgtttctgca      3000
     aaggcacctg catgtgtctg tgttcatgta ggcataatgt gaggaggtgg ggagaccacc      3060
     ccacccccat gtccaccatg accctcttcc cacgctgacc tgtgctccct ccccaa          3116
//