spacer

EBI Dbfetch

ID   JX564251; SV 1; linear; genomic DNA; STD; HUM; 2872 BP.
XX
AC   JX564251;
XX
DT   14-APR-2013 (Rel. 116, Created)
DT   14-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44:02:27 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2872
RX   DOI; 10.1111/tan.12065.
RX   PUBMED; 23510421.
RA   van Soest M., Rosel M., de Graaff A., Zwan B., Spierings E.;
RT   "The novel HLA-B*44:02:27 allele, identified by sequencing-based typing of
RT   a candidate stem-cell donor";
RL   Tissue Antigens 81(4):230-231(2013).
XX
RN   [2]
RP   1-2872
RA   de Graaff A., van Soest M., Rosel M., Zwan B., Spierings E.;
RT   ;
RL   Submitted (31-AUG-2012) to the INSDC.
RL   Immunology, UMC Utrecht, Heidelberglaan 100, Utrecht, Utrecht 3584CX, The
RL   Netherlands
XX
DR   MD5; 6ca96787a367bd1ce0838f941140cb81.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
DR   IMGT/HLA; B*44:02:27; HLA08601.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SBT engine v. 2.19.0.0
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2872
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <162..>2837
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:02:27"
FT   mRNA            join(<162..234,364..633,877..1152,1728..2003,2097..2213,
FT                   2655..2687,2794..>2837)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:02:27"
FT                   /product="MHC class I antigen"
FT   CDS             join(162..234,364..633,877..1152,1728..2003,2097..2213,
FT                   2655..2687,2794..2837)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:02:27"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D5H3J5"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3J5"
FT                   /protein_id="AGI65158.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 2872 BP; 536 A; 854 C; 911 G; 571 T; 0 other;
     caacctatgt cgggtccttc ttccaggata ctcgtgacgc gtccccattt cccactccca        60
     ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg gggtcccagt tctaaagtcc       120
     ccacgcaccc acccggactc agaatctcct cagacgccga gatgcgggtc acggcgcccc       180
     gaaccctcct cctgctgctc tggggggcag tggccctgac cgagacctgg gccggtgagt       240
     gcggggtcgg gagggaaatg gcctctgtgg ggaggagaga ggggaccgca ggcgggggcg       300
     caggacccgg ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc       360
     caggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc       420
     cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc gacagcgacg       480
     ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt       540
     gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag aacctgcgca       600
     ccgcgctccg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       660
     tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc       720
     cgcccccgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt       780
     acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg       840
     ctcgggggac ggggctgacc gcggggccgg ggccagggtc tcacatcatc cagaggatgt       900
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gtatgaccag gacgcctacg       960
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg      1020
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct      1080
     acctggaggg cctgtgcgtg gagtcgctcc gcagatacct ggagaacggg aaggagacgc      1140
     tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc atctcctata ggtcgccggg      1200
     gatggcctcc cacgagaaga ggaggaaaat gggatcagcg ctagaatgtc gccctccctt      1260
     gaatggagaa tggcatgagt tttcctgagt ttcctctgag ggccccctct tctctctagg      1320
     acaattaagg gatgacgtct ctgaggaaat ggaggggaag acagtcccta gaatactgat      1380
     caggggtccc ctttgacccc tgcagcagcc ttgggaaccg tgacttttcc tctcaggcct      1440
     tgttctctgc ctcacactca gtgtgtttgg ggctctgatt ccagcacttc tgagtcactt      1500
     tacctccact cagatcagga gcagaagtcc ctgttccccg ctcagagact cgaactttcc      1560
     aatgaatagg agattatccc aggtgcctgc gtccaggctg gtgtctgggt tctgtgcccc      1620
     ttccccaccc caggtgtccc gtccattctc aggctggtca catgggtggt cctagggtgt      1680
     cccatgagag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc ccccaaagac      1740
     acatgtgacc caccacccca tctctgacca tgaggtcacc ctgaggtgct gggccctggg      1800
     cttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc aaactcagga      1860
     caccgagctt gtggagacca gaccagcagg agatagaacc ttccagaagt gggcagctgt      1920
     ggtggtgcct tctggagaag agcagagata cacatgccat gtacagcatg aggggctgcc      1980
     gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc tcttctcagg      2040
     gaaagcagga gcccttcagc agggtcaggg cccctcatct tcccttcctt tcccagagcc      2100
     gtcttcccag tccactgtcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt      2160
     tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg aggaagagct caggtaggga      2220
     aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag ccccaggtag      2280
     aagtgttccc tgcctcatta ctgggaagca gcatccacac aggggctaac gcagcctggg      2340
     accctgtgtg ccagcactta ctcttttgtg cagcacatgt gacaatgaag gacggatgta      2400
     tcaccttggt ggttgtggtg ttggggtcct gattccagca ttcatgagtc aggggaaggt      2460
     ccctgctaag gacagacctt aggagggcag ttggtccagg acccacactt gctttcctcg      2520
     tgtttcctga tcctgccttg ggtctgtagt catacttctg gaaattcctt ttgggtccaa      2580
     gacgaggagg ttcctctaag atctcatggc cctgcttcct cccagtcccc tcacagggca      2640
     ttttcttccc acaggtggaa aaggagggag ctactctcag gctgcgtgta agtgatgggg      2700
     gcgggagtgt ggaggagctc acccacccca taattcctcc tgtcccacgt ctcctgcggg      2760
     ctctgaccag gtcctgtttt tgttctactc caggcagcga cagtgcccag ggctctgatg      2820
     tgtctctcac agcttgaaaa ggtgagattc ttggggtcta gagtgggtgg gg              2872
//


spacer
spacer