spacer

EBI Dbfetch

ID   JX564250; SV 1; linear; genomic DNA; STD; HUM; 3310 BP.
XX
AC   JX564250;
XX
DT   14-APR-2013 (Rel. 116, Created)
DT   14-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*29:46 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3310
RA   de Hoop T.A., Postma S., Lake S.L., Yildiz C., Spierings E.;
RT   "The novel HLA-A*29:46 allele, identified by sequencing-based typing of a
RT   cord blood donor";
RL   Unpublished.
XX
RN   [2]
RP   1-3310
RA   de Hoop T.A., Postma S., Lake S.L., Yildiz C., Spierings E.;
RT   ;
RL   Submitted (30-AUG-2012) to the INSDC.
RL   Immunology, UMC Utrecht, Heidelberglaan 100, Utrecht, Utrecht 3584CX, The
RL   Netherlands
XX
DR   IMGT/HLA; A*29:46; HLA08600.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SBT engine v. 2.19.0.0
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3310
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <191..>3108
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29:46"
FT   mRNA            join(<191..263,393..662,904..1179,1780..2055,2155..2271,
FT                   2712..2744,2887..2934,3104..>3108)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29:46"
FT                   /product="MHC class I antigen"
FT   CDS             join(191..263,393..662,904..1179,1780..2055,2155..2271,
FT                   2712..2744,2887..2934,3104..3108)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29:46"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:M9R644"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:M9R644"
FT                   /protein_id="AGI65157.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETKPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
XX
SQ   Sequence 3310 BP; 627 A; 958 C; 1007 G; 718 T; 0 other;
     aactccgcag tttcttttct ccctctgcca acctatgtag ggtccttctt cctggatact        60
     cacgacgcgg acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag       120
     tgtcgtcgcg gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccca       180
     gacgccgagg atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct       240
     ggccctgacc cagacctggg cgggtgagtg cggggtcgtg gggaaaccgc ctctgcgggg       300
     agaagcaagg ggcccgcccg gcggggacgc aggacccggg tagccgcgcc gggaggaggg       360
     tcgggtgggt ctcagccact cctcgccccc aggctcccac tccatgaggt atttcaccac       420
     atccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccgtgggct acgtggacga       480
     cacgcagttc gtgcggtttg acagcgacgc cgcgagccag aggatggagc cgcgggcacc       540
     gtggatagag caggaggggc cggagtattg ggacctgcag acacggaatg tgaaggccca       600
     gtcacagact gaccgagcga acctggggac cctgcgcggc tactacaacc agagcgaggc       660
     cggtgagtga ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggccg       720
     ggtcgcccac agtctccggg tccgagatcc accccgaagc cgcgggaccc cgagaccctt       780
     gccccgggag aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc       840
     ccccgggttg gtcggggccg gacggggctc gggggactgg gctgaccgtg gggtcggggc       900
     caggttctca caccatccag atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc       960
     tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc      1020
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg      1080
     cccgtgtggc ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca      1140
     gatacctgga gaacgggaag gagacgctgc agcgcacggg taccgggggc cacggggcgc      1200
     ctccctgatc gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg      1260
     accaacacta gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc      1320
     cagatcctgt accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg      1380
     ataaaatctc tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct      1440
     ttgacacaca ccggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg      1500
     cttcacactc aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac      1560
     tcaggtcagg accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag      1620
     gagattatcc caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat      1680
     cccaggtgtc ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac      1740
     agatgcaaaa tgcctgaatg ttctgactct tcctgacaga cgcccccaag acgcatatga      1800
     ctcaccacgc tgtctctgac catgaggcca ccctgaggtg ctgggccctg agcttctacc      1860
     ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc      1920
     ttgtggagac caagcctgca ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc      1980
     cttctggaca ggagcagaga tacacctgcc atgtgcagca tgagggtctg cccaagcccc      2040
     tcaccctgag atggggtaag gagggagatg ggggtgtcat gtcttttagg gaaagcagga      2100
     gcctctctga cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt      2160
     cttcccagcc caccatcccc atcgtgggca tcattgctgg cctagttctc tttggagctg      2220
     tgttcgctgg agctgtggtc gctgctgtga ggtggaggag gaagagctca ggtggggtga      2280
     agggatgaag ggtgggtctg agatttcttg tctcactgag ggttccaaga cccaggtaga      2340
     agtgtgccct gcctcgttac tgggaagcac catccacaat tatgggccta cccagcctgg      2400
     gccctgtgtg ccagcactta ctcttttgta aagcacctgt taaaatgaag gacagattta      2460
     tcaccttgat tacggcggtg atgggacctg atcccagcag tcacaagtca caggggaagg      2520
     tccctgagga ccttcaggag ggcggttggt ccaggaccca cacctgcttt cttcatgttt      2580
     cctgatcccg ccctgggtct gcagtcacac atttctggaa acttctctga ggtccaagac      2640
     ttggaggttc ctctaggacc ttaaggccct ggctcctttc tggtatctca caggacattt      2700
     tcttcccaca gatagaaaag gagggagcta ctctcaggct gcaagtaagt atgaaggagg      2760
     ctgatgcctg aggtccttgg gatattgtgt ttgggagccc gtgggggagc tcacccaccc      2820
     cacaattcct cctctagcca catcttctgt gggatctgac caggttctgt ttttgtccta      2880
     ccccaggcag tgacagtgcc cagggctctg atatgtctct cacagcttgt aaaggtgaga      2940
     gcctggaggg cctgatgtgt gttgggtgtt gggcggaaca gtggacgcag ctgtgctatg      3000
     gggtttcttt gcattggatg tattgagcat gcgatgggct gtttaaagtg tgactcctca      3060
     ctgtgacaga tacgaatttg ttcatgaata tttttttcta tagtgtgaga cagctgcctt      3120
     gtgtgggact gagaggcaag atttgttcct gcccttccct ttgtgacttg aagaaccctg      3180
     actttgtttc tgcaaaggca cctgcatgtg tctgtgttct tgtaggcata atgtgaggag      3240
     gtggggagac caccccaccc ccatgtccac catgaccctc ttcccacgct gacctgtgct      3300
     ccctccccaa                                                             3310
//


spacer
spacer