Dbfetch

ID   JX524131; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   JX524131;
XX
DT   28-OCT-2012 (Rel. 114, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*26 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/tan.12194.
RX   PUBMED; 23998206.
RA   Zhang W., He Y.M., He J., Zhu F.M., Lv H.J.;
RT   "Identification of the novel HLA-A*26:79 allele by polymerase chain
RT   reaction sequence-based typing in a Chinese individual";
RL   Tissue Antigens 82(4):294-295(2013).
XX
RN   [2]
RP   1-1022
RA   Zhu F., He J., Wang W., Zhang W., Lv H.;
RT   ;
RL   Submitted (23-AUG-2012) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 4763420d6303a6f5e81584b987f31678.
DR   IMGT/HLA; A*26:79; HLA08598.
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="5751100703"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:K4NRQ4"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:K4NRQ4"
FT                   /protein_id="AFV46223.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRRYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             647..746
FT                   /estimated_length=unknown
XX
SQ   Sequence 1022 BP; 168 A; 249 C; 286 G; 119 T; 200 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcaggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaagacg catatgactc accacgctgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatgggacct tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//