spacer

EBI Dbfetch

ID   JX494227; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   JX494227;
XX
DT   23-OCT-2012 (Rel. 114, Created)
DT   23-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*05 variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Hoffman A.D., Scott I., Palmer P., Partel R., Endres R.O.;
RT   "Characterization of a Novel DQB1*05 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Hoffman A.D., Scott I., Palmer P., Partel R., Endres R.O.;
RT   ;
RL   Submitted (15-AUG-2012) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W. Erie Dr., Tempe, AZ
RL   85282, USA
XX
DR   MD5; d470385b0358ab1ee27a99a7c843bd3f.
DR   IMGT/HLA; DQB1*05:17; HLA08596.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /isolation_source="peripheral blood"
FT                   /collection_date="02-Jul-2012"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:K4MJ59"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K4MJ59"
FT                   /protein_id="AFV26062.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAV
FT                   TPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLICSVTDFYPSHIKVRWFRNDQEETAGVVSTPLIRNGDWTFQTLVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /number=3
XX
SQ   Sequence 652 BP; 122 A; 160 C; 177 G; 93 T; 100 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tgatctgctc ggtgacagat ttctatccaa gccacatcaa agtccggtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca cccccctcat taggaacggt       540
     gactggacct tccagaccct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer