Dbfetch

ID   JX470440; SV 1; linear; genomic DNA; STD; HUM; 2065 BP.
XX
AC   JX470440;
XX
DT   15-OCT-2012 (Rel. 114, Created)
DT   15-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*15new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2065
RA   Kwon O.-J., Kim H.-S.;
RT   ;
RL   Submitted (08-AUG-2012) to the INSDC.
RL   Molecular Genetics, Biowithus, Inc./Konkuk University, #508, Woolim e-BIZ
RL   Center, 280-21, Seongsu-dong 2-ga, Seongdong-gu, Seoul 133-120, Republic of
RL   Korea
XX
DR   MD5; bba602bd0c6738a5dd2430f1271e7d85.
DR   IMGT/HLA; B*15:263; HLA08595.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2065
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2065
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT   mRNA            join(<1..73,203..472,718..993,1569..1844,1949..>2065)
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,718..993,1569..1844,1949..>2065)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="B*15new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:K4IA16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:K4IA16"
FT                   /protein_id="AFU65881.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPCGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
XX
SQ   Sequence 2065 BP; 386 A; 636 C; 676 G; 367 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacgcagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       360
     caggaggggc cggagtattg ggaccggaac acacagatct gcaagaccaa cacacagact       420
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcctg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccctga ggccgcggga cccgcccaaa ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggcct gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcatgacca gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     aggcggagca gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct aggatagtga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacatgtgac ccaccacccc atctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acaccgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttgtggagaa gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcatat ctgttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcat cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      1980
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2040
     gtgatgtgta ggaggaagag ctcag                                            2065
//