spacer

EBI Dbfetch

ID   JX467694; SV 1; linear; genomic DNA; STD; HUM; 260 BP.
XX
AC   JX467694;
XX
DT   15-OCT-2012 (Rel. 114, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14 new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-260
RX   DOI; 10.1111/tan.12081.
RX   PUBMED; 23510420.
RA   Testi M., Battarra M., Stellitano C., Condello R., Andreani M.;
RT   "Detection of the new HLA-DRB1*14:129 allele in a voluntary stem cell
RT   donor";
RL   Tissue Antigens 81(4):229-230(2013).
XX
RN   [2]
RP   1-260
RA   Testi M., Condello R., Stellitano C., Troiano M., Andreani M.;
RT   ;
RL   Submitted (07-AUG-2012) to the INSDC.
RL   Tor Vergata Hospital, LIBT Fondazione IME, viale Oxford 81, Rome, RM 00133,
RL   Italy
XX
DR   MD5; a376985f7804f293056be49514180dd5.
DR   IMGT/HLA; DRB1*14:129; HLA08565.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..260
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>260
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 new"
FT   mRNA            <1..>260
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>260
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:K4IT57"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K4IT57"
FT                   /protein_id="AFU73595.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGGYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTV"
XX
SQ   Sequence 260 BP; 51 A; 62 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggggtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg                                                   260
//


spacer
spacer