Dbfetch

ID   JX402910; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   JX402910;
XX
DT   03-SEP-2012 (Rel. 114, Created)
DT   03-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44:03:01V allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Zhao W., Moul D., Oyediran K., Partlow D., Cao K.;
RT   "Novel Sequences of HLA Allele B*44:03:01 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-789
RA   Zhao W., Moul D., Oyediran K., Partlow D., Cao K.;
RT   ;
RL   Submitted (19-JUL-2012) to the INSDC.
RL   HLA Laboratory, Dept of Laboratory Medicine, UT MD Anderson Cancer Center,
RL   8515 Fannin Street, Houston, TX 77054, USA
XX
DR   MD5; 9d0fd4252d7edb33ae9274d832aab1c7.
DR   IMGT/HLA; B*44:160Q; HLA08432.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Assign v. 3.5.1.42
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:03:01V"
FT   mRNA            join(<1..270,514..>789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:03:01V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:03:01V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:J7JQE2"
FT                   /protein_id="AFQ55493.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLY
FT                   VESLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:03:01V"
FT                   /number=2
FT   gap             271..513
FT                   /estimated_length=243
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:03:01V"
FT                   /number=3
XX
SQ   Sequence 789 BP; 114 A; 173 C; 187 G; 72 T; 243 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca catcatccag aggatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcct gtacgtggag tcgctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//