spacer

EBI Dbfetch

ID   JX402909; SV 1; linear; genomic DNA; STD; HUM; 1641 BP.
XX
AC   JX402909;
XX
DT   03-SEP-2012 (Rel. 114, Created)
DT   03-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*01:01:01:01V allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1641
RA   Zhao W., Willis D., Moul D., Oyediran K., Brooks K., Wang Q., Partlow D.,
RA   Cao K.;
RT   "Novel sequences of HLA Allele A*01:01:01:01 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1641
RA   Zhao W., Willis D., Moul D., Oyediran K., Brooks K., Wang Q., Partlow D.,
RA   Cao K.;
RT   ;
RL   Submitted (19-JUL-2012) to the INSDC.
RL   HLA Laboratory, Dept of Laboratory Medicine, UT MD Anderson Cancer Center,
RL   8515 Fannin Street, Houston, TX 77054, USA
XX
DR   MD5; cceaab2ee661d29188d856545b3b7d82.
DR   IMGT/HLA; A*01:114; HLA08557.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Assign v. 3.5.1.42
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1641
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT   mRNA            join(<1..270,512..787,1366..>1641)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1366..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:J7JHS1"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:J7JHS1"
FT                   /protein_id="AFQ55492.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYLDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT                   /number=3
FT   gap             788..1365
FT                   /estimated_length=578
FT   exon            1366..1641
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01V"
FT                   /number=4
XX
SQ   Sequence 1641 BP; 171 A; 251 C; 282 G; 118 T; 819 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtatttgg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggtc catgcggcgg agcagcggag agtctacctg       720
     gagggccggt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnacccc cccaagacac      1380
     atatgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag acccaggaca      1500
     cggagctcgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg gcggctgtgg      1560
     tggtgccttc tggagaggag cagagataca cctgccatgt gcagcatgag ggtctgccca      1620
     agcccctcac cctgagatgg g                                                1641
//


spacer
spacer