spacer

EBI Dbfetch

ID   JX315459; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX315459;
XX
DT   30-SEP-2012 (Rel. 114, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13:02new
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23126463.
RA   Kim K.M., Sung H.Y., Kang M.S., Huh J.Y.;
RT   "Identification of two novel HLA alleles: HLA-DRB1*12:03:03 and
RT   HLA-DRB1*13:143";
RL   Tissue Antigens 81(1):58-59(2013).
XX
RN   [2]
RP   1-270
RA   Huh J.Y., Sung H.Y.;
RT   ;
RL   Submitted (16-JUL-2012) to the INSDC.
RL   Laboratory Medicine, CHA Bundang Medical Center, CHA University, 351
RL   Yatap-dong, Bundang-gu, Seongnam-si, Gyeonggi-do 463-712, South Korea
XX
DR   MD5; 303f2cf741343c94fe147cfa2dd98cfb.
DR   IMGT/HLA; DRB1*13:143; HLA08430.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:02new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:02new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:02new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:J9Z200"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:J9Z200"
FT                   /protein_id="AFS49949.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGFGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggt       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer