spacer

EBI Dbfetch

ID   JX310102; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JX310102;
XX
DT   09-OCT-2012 (Rel. 114, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*09:new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23330724.
RA   Hommel-Berrey G.A., House K.D., Backfish K.A., Arnoff T.S.,
RA   Lobashevsky A.L.;
RT   "Identification of a novel HLA-DRB1 allele, DRB1*09:20, by sequence-based
RT   typing in an unrelated bone marrow donor";
RL   Tissue Antigens 81(2):125-126(2013).
XX
RN   [2]
RP   1-270
RA   Hommel-Berrey G.A., House K.D., Lobashevsky A.;
RT   ;
RL   Submitted (13-JUL-2012) to the INSDC.
RL   Medicine, Indiana University, 705 Riley Hospital Drive, Indianapolis, IN
RL   46202, USA
XX
DR   IMGT/HLA; DRB1*09:20; HLA08429.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09:new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09:new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09:new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:K4HPL6"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K4HPL6"
FT                   /protein_id="AFU52874.1"
FT                   /translation="RFLQQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09:new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 102 G; 47 T; 0 other;
     cacgtttctt gcagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer