Dbfetch

ID   JX284120; SV 1; linear; genomic DNA; STD; HUM; 1650 BP.
XX
AC   JX284120;
XX
DT   17-SEP-2012 (Rel. 114, Created)
DT   17-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B3901V allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1650
RA   Lee Y.-J.;
RT   "A novel HLA-B allele found in a Taiwanese individual";
RL   Unpublished.
XX
RN   [2]
RP   1-1650
RA   Lee Y.-J.;
RT   ;
RL   Submitted (02-JUL-2012) to the INSDC.
RL   Departments of Pediatrics, Mackay Memorial Hospital, 45 Minsheng Rd.,
RL   Tamsui District, New Taipei City 25160, Taiwan
XX
DR   MD5; 05f407dfeede4348aa607ea2fe216f15.
DR   IMGT/HLA; B*39:01:15; HLA08597.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1650
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1650
FT                   /gene="HLA-B"
FT                   /allele="HLA-B3901V"
FT   mRNA            join(<11..280,527..802,1375..>1650)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B3901V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,527..802,1375..>1650)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B3901V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:J9S2M4"
FT                   /protein_id="AFR54425.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             803..1374
FT                   /estimated_length=572
XX
SQ   Sequence 1650 BP; 213 A; 353 C; 366 G; 146 T; 572 other;
     tcgcccccag gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc        60
     ggggagcccc gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac       120
     agcgacgccg cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg       180
     gaatattggg accggaacac acagatctgc aagaccaaca cacagactga ccgagagagc       240
     ctgcggaacc ttcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc       540
     cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag       600
     ttcgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg       660
     gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag       720
     ctgagaacct acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg       780
     aaggagacgc tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnaccccc      1380
     caaagacaca tgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg      1440
     ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa      1500
     ctcaggacac cgagcttgtg gagaccagac cagcaggaga cagaaccttc cagaagtggg      1560
     cagctgtggt ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg      1620
     ggctgccgaa gcccctcacc ctgagatggg                                       1650
//